DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12344 and Gabra2

DIOPT Version :9

Sequence 1:NP_001286298.1 Gene:CG12344 / 36145 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_017454595.1 Gene:Gabra2 / 289606 RGDID:61856 Length:504 Species:Rattus norvegicus


Alignment Length:481 Identity:129/481 - (26%)
Similarity:212/481 - (44%) Gaps:94/481 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FGLGFILMWLS--------EATEAHMNYTAKPRVV--LPPNYVKEIRPPSKKGSPVIVDF-SIFV 66
            |.|..:|:|..        :..||..|.|...|::  |...|...:||  ..|..:...| :|:|
  Rat    65 FPLLVLLVWNPARLVLANIQEDEAKNNITIFTRILDRLLDGYDNRLRP--GLGDSITEVFTNIYV 127

  Fly    67 VDINSINVEDMDFRVDMFIHQRWLESRLEIPDDIFEEGDDYVTLLPEVFENFWQPDPYFLNSK-- 129
            .....::..||::.:|:|..|:|.:.||:     |:...:.:.|...:....|.||.:|.|.|  
  Rat   128 TSFGPVSDTDMEYTIDVFFRQKWKDERLK-----FKGPMNILRLNNLMASKIWTPDTFFHNGKKS 187

  Fly   130 IAEIATLTHKFTSVTLYKNKTVRYAARMHAIIACQMEFQLYPMDIQVCPIYIESFSSNNQKVKLR 194
            :|...|:.:|.  :.:..:.|:.|..|:.....|.|..:.:|||...||:...|::....:|...
  Rat   188 VAHNMTMPNKL--LRIQDDGTLLYTMRLTVQAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVTYI 250

  Fly   195 W----SDSGVTLNPE-LKLLQYN-LGQPLELEESDGYMPEKVGNFSRLTVYFRFERQIGHHLIQT 253
            |    ||| |.:.|: .:|.||: |||.:..|.    :....|.::.:|.:|..:|:||:.:|||
  Rat   251 WTYNASDS-VQVAPDGSRLNQYDLLGQSIGKET----IKSSTGEYTVMTAHFHLKRKIGYFVIQT 310

  Fly   254 FAPSSLVVMLSWFSFWLGLDAIPGRVTLLVTCMLTLVTMFTGA--DIPPVAYVKALDLWMAGCML 316
            :.|..:.|:||..||||..:::|.|....||.:||:.|:...|  .:|.|||..|:|.::|.|..
  Rat   311 YLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYA 375

  Fly   317 SVFAALAEFVVVKVLDVQYQYQVNRIPKVLPMRISNMEKGQCATVASWEGGAVRSRK-------- 373
            .||:||.||..|...                     .::|.     :|:|.:|.:.|        
  Rat   376 FVFSALIEFATVNYF---------------------TKRGW-----AWDGKSVVNDKKKEKGSVM 414

  Fly   374 ----------ATQTPT---TPGQTSLQGNGGPPKPARRQSLLSVAWTDTDTGVEKIMWREIDKVS 425
                      |...|.   .|..:::..:...|:|.::..........|...|.|     ||::|
  Rat   415 IQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFNSVSK-----IDRMS 474

  Fly   426 RAVFPILFFVFVLLYW-------PIL 444
            |.|||:||..|.|:||       |:|
  Rat   475 RIVFPVLFGTFNLVYWATYLNREPVL 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12344NP_001286298.1 LIC 8..441 CDD:273305 125/469 (27%)
Gabra2XP_017454595.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1057372at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.