DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12344 and GABRG3

DIOPT Version :9

Sequence 1:NP_001286298.1 Gene:CG12344 / 36145 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_011519732.1 Gene:GABRG3 / 2567 HGNCID:4088 Length:473 Species:Homo sapiens


Alignment Length:436 Identity:123/436 - (28%)
Similarity:196/436 - (44%) Gaps:64/436 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YVKEIRPPSKKG-SPVIVDFSIFVVDINSINVEDMDFRVDMFIHQRWLESRLEIPDDIFEEGDDY 107
            |.|::||..  | .|.::|..|:|..|..::..:|::::|:|..|.|.:|||.     |......
Human    58 YDKKLRPDI--GIKPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLR-----FNSTMKI 115

  Fly   108 VTLLPEVFENFWQPDPYFLNSKIAEIATLTHKFTSVTLYKNKTVRYAARMHAIIACQMEFQLYPM 172
            :||...:....|.||..|.|||.||...:|.....:.::.:..:.|..|:.....||::...:||
Human   116 LTLNSNMVGLIWIPDTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPM 180

  Fly   173 DIQVCPIYIESFSSNNQKVKLRWSDSGVTL--NPELKLLQYNLGQPLELEESDGYMPEKVGNFSR 235
            |...||:...|:....:::..||..:.|..  ....:|.|::.   :.|..:...:....|::..
Human   181 DEHSCPLIFSSYGYPKEEMIYRWRKNSVEAADQKSWRLYQFDF---MGLRNTTEIVTTSAGDYVV 242

  Fly   236 LTVYFRFERQIGHHLIQTFAPSSLVVMLSWFSFWLGLDAIPGRVTLLVTCMLTLVTMFTGA--DI 298
            :|:||...|::|:..|||:.|..|.|:|||.|||:..||.|.|..|.:|.:||:.|:.|.|  .:
Human   243 MTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTALGITTVLTMTTLSTIARKSL 307

  Fly   299 PPVAYVKALDLWMAGCMLSVFAALAEFVVVKVLDVQYQYQVNRIPKVLPMRISNMEKGQCATVAS 363
            |.|:||.|:||::..|.|.|||||.|:..:.      .|...|.|.......|.:....    :.
Human   308 PRVSYVTAMDLFVTVCFLFVFAALMEYATLN------YYSSCRKPTTTKKTTSLLHPDS----SR 362

  Fly   364 WEGGAVRSRKATQTPTTPGQTSLQG----NGGPPKPARRQSLLSVAWTD-TDTGVEKIM------ 417
            |    :..|.:.|.|:.  :.:||.    :..||..|......||.|.: .||.|.:.:      
Human   363 W----IPERISLQAPSV--RIALQNYSLLDMRPPPTAMITLNNSVYWQEFEDTCVYECLDGKDCQ 421

  Fly   418 -------------WR---------EIDKVSRAVFPILFFVFVLLYW 441
                         ||         |:|..||..||..|.:|.|:||
Human   422 SFFCCYEECKSGSWRKGRIHIDILELDSYSRVFFPTSFLLFNLVYW 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12344NP_001286298.1 LIC 8..441 CDD:273305 121/434 (28%)
GABRG3XP_011519732.1 Neur_chan_LBD 48..253 CDD:280998 52/204 (25%)
LIC 50..470 CDD:273305 123/436 (28%)
Neur_chan_memb 260..467 CDD:280999 66/222 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1057372at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.