DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12344 and GABRG2

DIOPT Version :9

Sequence 1:NP_001286298.1 Gene:CG12344 / 36145 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_944493.2 Gene:GABRG2 / 2566 HGNCID:4087 Length:515 Species:Homo sapiens


Alignment Length:519 Identity:126/519 - (24%)
Similarity:216/519 - (41%) Gaps:105/519 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FNTNAFISFGLGFILMWLS--------EATEAHMNYTAKPRVVLPP----------------NYV 45
            ::|..|......:||:.||        ::.:.:.:|.:....||.|                .|.
Human    14 YSTPVFSQKMTVWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYD 78

  Fly    46 KEIRPPSKKGSPVIVDFSIFVVDINSINVEDMDFRVDMFIHQRWLESRLEIPDDIFEEGDDYVTL 110
            .::||.... .|.::...::|..|..:|..:|::.:|:|..|.|.:.||:     |......:.|
Human    79 NKLRPDIGV-KPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLK-----FNSTIKVLRL 137

  Fly   111 LPEVFENFWQPDPYFLNSKIAEIATLTHKFTSVTLYKNKTVRYAARMHAIIACQMEFQLYPMDIQ 175
            ...:....|.||.:|.|||.|:...:|.....:.::.:..|.|..|:.....||::...:|||..
Human   138 NSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEH 202

  Fly   176 VCPIYIESFSSNNQKVKLRWSDSGVTLNPELKLLQYNLGQPLELEE-----SDGYMPEKV----- 230
            .||:   .|||.::.:......||| ::....|..:....|..|..     ||||..|::     
Human   203 SCPL---EFSSWSRSIAQAGMCSGV-ISAHYSLRFWGSTDPPTLASRVAGISDGYPREEIVYQWK 263

  Fly   231 ---------------------------------GNFSRLTVYFRFERQIGHHLIQTFAPSSLVVM 262
                                             |::..::|||...|::|:..|||:.|.:|:|:
Human   264 RSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVV 328

  Fly   263 LSWFSFWLGLDAIPGRVTLLVTCMLTLVTMFTGA--DIPPVAYVKALDLWMAGCMLSVFAALAEF 325
            |||.|||:..||:|.|.:|.:|.:||:.|:.|.|  .:|.|:||.|:||:::.|.:.||:||.|:
Human   329 LSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEY 393

  Fly   326 VVVKVLDVQYQYQVNRIPKVLPMRISNMEKGQCATVASWEGGAVRSRKATQTPTTPGQTSLQGN- 389
            ..:      :.:..||.|.   ......:|.....:.|::...:..|..:.|......|.||.. 
Human   394 GTL------HYFVSNRKPS---KDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQMNNATHLQERD 449

  Fly   390 ---GGPPKPARRQSLLSVAWTDTDTGVEKIMWR---------EIDKVSRAVFPILFFVFVLLYW 441
               |......:..:.....:.|..||.    ||         ::|..:|..||..|.:|.|:||
Human   450 EEYGYECLDGKDCASFFCCFEDCRTGA----WRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYW 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12344NP_001286298.1 LIC 8..441 CDD:273305 123/514 (24%)
GABRG2NP_944493.2 LIC 69..512 CDD:273305 116/464 (25%)
Neur_chan_LBD 69..312 CDD:280998 54/252 (21%)
Neur_chan_memb 319..509 CDD:280999 57/202 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1057372at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.