DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12344 and GABRG1

DIOPT Version :9

Sequence 1:NP_001286298.1 Gene:CG12344 / 36145 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_775807.2 Gene:GABRG1 / 2565 HGNCID:4086 Length:465 Species:Homo sapiens


Alignment Length:434 Identity:113/434 - (26%)
Similarity:194/434 - (44%) Gaps:85/434 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YVKEIRPPSKKGSPVIVDFSIFVVDINSINVEDMDFRVDMFIHQRWLESRLEIPDDIFEEGDDYV 108
            |..::||.... .|.:::..::|..|..::..:|::.:|:...|.|.:|||:     |......:
Human    75 YDNKLRPDIGV-RPTVIETDVYVNSIGPVDPINMEYTIDIIFAQTWFDSRLK-----FNSTMKVL 133

  Fly   109 TLLPEVFENFWQPDPYFLNSKIAEIATLTHKFTSVTLYKNKTVRYAARMHAIIACQMEFQLYPMD 173
            .|...:....|.||.:|.||:.::...:|.....:.::.:..|.|..|:.....|.::...:|||
Human   134 MLNSNMVGKIWIPDTFFRNSRKSDAHWITTPNRLLRIWNDGRVLYTLRLTINAECYLQLHNFPMD 198

  Fly   174 IQVCPIYIESFSSNNQKVKLRWSDSGVTL-NPEL-KLLQYNLGQPLELEESDGYMPEKVGNFSRL 236
            ...||:...|:.....:::.:|....|.: :|:. :|.|:..   :.|..|........|::..:
Human   199 EHSCPLEFSSYGYPKNEIEYKWKKPSVEVADPKYWRLYQFAF---VGLRNSTEITHTISGDYVIM 260

  Fly   237 TVYFRFERQIGHHLIQTFAPSSLVVMLSWFSFWLGLDAIPGRVTLLVTCMLTLVTMFTGA--DIP 299
            |::|...|::|:..|||:.|..|.|:|||.|||:..||:|.|.:|.:|.:||:.|:.|.|  .:|
Human   261 TIFFDLSRRMGYFTIQTYIPCILTVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLP 325

  Fly   300 PVAYVKALDLWMAGCMLSVFAALAEFVVVKVLDVQYQYQVNRIPKVLPMRISNMEKGQCATVASW 364
            .|:||.|:||:::.|.:.|||||.|:..:..                   .::.:||:.||    
Human   326 KVSYVTAMDLFVSVCFIFVFAALMEYGTLHY-------------------FTSNQKGKTAT---- 367

  Fly   365 EGGAVRSR----KATQTP-TTPGQTSLQGNGGPPKPARRQSLLSVAWTDTDTGVEKI-------- 416
                 :.|    ||:.|| ..||.|.:..|.           :||...| |.|.:.:        
Human   368 -----KDRKLKNKASMTPGLHPGSTLIPMNN-----------ISVPQED-DYGYQCLEGKDCASF 415

  Fly   417 ----------MWRE---------IDKVSRAVFPILFFVFVLLYW 441
                      .|||         ||..||..||..|.:|.|:||
Human   416 FCCFEDCRTGSWREGRIHIRIAKIDSYSRIFFPTAFALFNLVYW 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12344NP_001286298.1 LIC 8..441 CDD:273305 111/432 (26%)
GABRG1NP_775807.2 LIC 66..462 CDD:273305 113/434 (26%)
LGIC_ECD_GABAAR_G 88..269 CDD:349801 38/188 (20%)
Cys-loop 188..202 CDD:349801 4/13 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1057372at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.