DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12344 and GABRB3

DIOPT Version :9

Sequence 1:NP_001286298.1 Gene:CG12344 / 36145 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_000805.1 Gene:GABRB3 / 2562 HGNCID:4083 Length:473 Species:Homo sapiens


Alignment Length:454 Identity:131/454 - (28%)
Similarity:212/454 - (46%) Gaps:75/454 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NYVKE----------IR-PPSKKGSPVIVDFSIFVVDINSINVEDMDFRVDMFIHQRWLESRLE- 95
            ::|||          || .|...|.||.|..:|.:..|:.::..:||:.:.|:..|.|.:.||. 
Human    35 SFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAY 99

  Fly    96 --IPDDIFEEGDDYVTLLPEVFENFWQPDPYFLNSKIAEIATLTHKFTSVTLYKNKTVRYAARMH 158
              ||.::        ||...|.:..|.||.||||.|.:.:..:|.|...:.|:.:.||.|..|:.
Human   100 SGIPLNL--------TLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRIT 156

  Fly   159 AIIACQMEFQLYPMDIQVCPIYIESFSSNNQKVKLRW--SDSGVTLNPELKLLQYNLGQPLELEE 221
            ...||.|:.:.||:|.|.|.:.|||:......::..|  .|..||....::|.|:::.:...:..
Human   157 TTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSR 221

  Fly   222 SDGYMPEKVGNFSRLTVYFRFERQIGHHLIQTFAPSSLVVMLSWFSFWLGLDAIPGRVTLLVTCM 286
            :..:   ..|.:.||::.||.:|.||:.::||:.||.|:.:|||.|||:..||...||.|.:|.:
Human   222 NVVF---ATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTV 283

  Fly   287 LTLVTMFT--GADIPPVAYVKALDLWMAGCMLSVFAALAEFVVV--------------------K 329
            ||:.|:.|  ...:|.:.||||:|:::.||.:.||.||.|:..|                    |
Human   284 LTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAK 348

  Fly   330 VLDVQYQYQVNRIPKVLPMRISNMEK-----------GQCATVA-SWEGGAVRSRKATQTPTTPG 382
            ..:.:.:.:.||:.....:.::::|.           |.....| |::...::.||  |:....|
Human   349 AKNDRSKSESNRVDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRK--QSMPREG 411

  Fly   383 QTSLQGNGGPPKP----ARRQSLLSVAWTD-TDTGVEKIMWREIDKVSRAVFPILFFVFVLLYW 441
            .....|:...|..    .||.|.|.:...| ||...       ||:.||.|||..|.:|.|:||
Human   412 HGRFLGDRSLPHKKTHLRRRSSQLKIKIPDLTDVNA-------IDRWSRIVFPFTFSLFNLVYW 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12344NP_001286298.1 LIC 8..441 CDD:273305 129/452 (29%)
GABRB3NP_000805.1 LIC 10..471 CDD:273305 131/454 (29%)
Benzamidine binding, agonist. /evidence=ECO:0000269|PubMed:24909990 120..122 1/1 (100%)
Benzamidine binding, agonist. /evidence=ECO:0000269|PubMed:24909990, ECO:0007744|PDB:4COF 180..182 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.