DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12344 and GABRB1

DIOPT Version :9

Sequence 1:NP_001286298.1 Gene:CG12344 / 36145 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_000803.2 Gene:GABRB1 / 2560 HGNCID:4081 Length:474 Species:Homo sapiens


Alignment Length:486 Identity:140/486 - (28%)
Similarity:232/486 - (47%) Gaps:84/486 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ISFGLGFILMWLSEATE--AHMNYTAKPRVVLPPNYVKEIRPPSKKGSPVIVDFSIFVVDINSIN 73
            :||.:...::..:.:|.  ::|:|..:....|...|...:| |...|.||.|...|.|..|:.::
Human    13 LSFPVMITMVCCAHSTNEPSNMSYVKETVDRLLKGYDIRLR-PDFGGPPVDVGMRIDVASIDMVS 76

  Fly    74 VEDMDFRVDMFIHQRWLESRLE---IPDDIFEEGDDYVTLLPEVFENFWQPDPYFLNSKIAEIAT 135
            ..:||:.:.|:..|.|.:.||.   ||.::        ||...|.:..|.||.||||.|.:.:..
Human    77 EVNMDYTLTMYFQQSWKDKRLSYSGIPLNL--------TLDNRVADQLWVPDTYFLNDKKSFVHG 133

  Fly   136 LTHKFTSVTLYKNKTVRYAARMHAIIACQMEFQLYPMDIQVCPIYIESFSSNNQKVKLRWS--DS 198
            :|.|...:.|:.:.||.|..|:....||.|:.:.||:|.|.|.:.|||:......::..|:  :.
Human   134 VTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEG 198

  Fly   199 GVT-LN----PELKLLQYNLGQPLELEESDGYMPEKV----GNFSRLTVYFRFERQIGHHLIQTF 254
            .|| :|    |:..::.|.:            :.:||    |.:.||::.||.:|.||:.::||:
Human   199 AVTGVNKIELPQFSIVDYKM------------VSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTY 251

  Fly   255 APSSLVVMLSWFSFWLGLDAIPGRVTLLVTCMLTLVTMFT--GADIPPVAYVKALDLWMAGCMLS 317
            .||:|:.:|||.|||:..||...||.|.:|.:||:.|:.|  ...:|.:.||||:|:::.||.:.
Human   252 MPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVF 316

  Fly   318 VFAALAEFVVVKVL------------------DVQYQYQVNRIP-----KVL--PMRISNMEKGQ 357
            ||.||.|:..|..:                  :.:.:.::|::.     .:|  .:.|.|...|.
Human   317 VFLALLEYAFVNYIFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNILLSTLEIRNETSGS 381

  Fly   358 ---------CATVASWEGGAVRSRKATQTPTTPGQTSLQGNGGPPKP--ARRQSLLSVAWTD-TD 410
                     .||:.|::..:::.||...:....|: :|..:|.|.|.  .||.|.|.|...| ||
Human   382 EVLTSVSDPKATMYSYDSASIQYRKPLSSREAYGR-ALDRHGVPSKGRIRRRASQLKVKIPDLTD 445

  Fly   411 TGVEKIMWREIDKVSRAVFPILFFVFVLLYW 441
            .       ..|||.||..|||.|.:|.::||
Human   446 V-------NSIDKWSRMFFPITFSLFNVVYW 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12344NP_001286298.1 LIC 8..441 CDD:273305 138/484 (29%)
GABRB1NP_000803.2 LIC 9..472 CDD:273305 140/486 (29%)
Agonist binding. /evidence=ECO:0000250 120..122 1/1 (100%)
Agonist binding. /evidence=ECO:0000250 180..182 1/1 (100%)
Allosteric effector binding. /evidence=ECO:0000250 290..311 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.