DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12344 and GABRA2

DIOPT Version :9

Sequence 1:NP_001286298.1 Gene:CG12344 / 36145 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001317619.1 Gene:GABRA2 / 2555 HGNCID:4076 Length:511 Species:Homo sapiens


Alignment Length:520 Identity:133/520 - (25%)
Similarity:218/520 - (41%) Gaps:108/520 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ISFGLGFILMW------LS--EATEAHMNYTAKPRVV--LPPNYVKEIRPPSKKGSPVIVDF-SI 64
            :.|.|...|:|      |:  :..||..|.|...|::  |...|...:||  ..|..:...| :|
Human    10 MQFLLFVFLVWDPARLVLANIQEDEAKNNITIFTRILDRLLDGYDNRLRP--GLGDSITEVFTNI 72

  Fly    65 FVVDINSINVEDMDFRVDMFIHQRWLESRLEIPDDIFEEGDDYVTLLPEVFENFWQPDPYFLNSK 129
            :|.....::..||::.:|:|..|:|.:.||:     |:...:.:.|...:....|.||.:|.|.|
Human    73 YVTSFGPVSDTDMEYTIDVFFRQKWKDERLK-----FKGPMNILRLNNLMASKIWTPDTFFHNGK 132

  Fly   130 --IAEIATLTHKFTSVTLYKNKTVRYAARMHAIIACQMEFQLYPMDIQVCPIYIESFSSNNQKVK 192
              :|...|:.:|.  :.:..:.|:.|..|:.....|.|..:.:|||...||:...|::....:|.
Human   133 KSVAHNMTMPNKL--LRIQDDGTLLYTMRLTVQAECPMHLEDFPMDAHSCPLKFGSYAYTTSEVT 195

  Fly   193 LRW----SDSGVTLNPE-LKLLQYN-LGQPLELEESDGYMPEKVGNFSRLTVYFRFERQIGHHLI 251
            ..|    ||| |.:.|: .:|.||: |||.:..|.    :....|.::.:|.:|..:|:||:.:|
Human   196 YIWTYNASDS-VQVAPDGSRLNQYDLLGQSIGKET----IKSSTGEYTVMTAHFHLKRKIGYFVI 255

  Fly   252 QTFAPSSLVVMLSWFSFWLGLDAIPGRVTLLVTCMLTLVTMFTGA--DIPPVAYVKALDLWMAGC 314
            ||:.|..:.|:||..||||..:::|.|....||.:||:.|:...|  .:|.|||..|:|.::|.|
Human   256 QTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVC 320

  Fly   315 MLSVFAALAEFVVV-----------------------KVLDVQYQYQVNRIPKVLP--------- 347
            ...||:||.||..|                       |...:...|  |.:..:|.         
Human   321 YAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKSPSIKAEGITLTY--NSVKAILQGAKLIWSKY 383

  Fly   348 -----------------------MRISNMEKGQCATVASWEGGAVRSRKATQTPT---TPGQTSL 386
                                   :......|.:.|:|.. :..|.....|...|.   .|..:::
Human   384 IAFSWPSLFQEKTLEYLEKWMDCLTFKQSSKKEKASVMI-QNNAYAVAVANYAPNLSKDPVLSTI 447

  Fly   387 QGNGGPPKPARRQSLLSVAWTDTDTGVEKIMWREIDKVSRAVFPILFFVFVLLYW-------PIL 444
            ..:...|:|.::..........|...|.|     ||::||.|||:||..|.|:||       |:|
Human   448 SKSATTPEPNKKPENKPAEAKKTFNSVSK-----IDRMSRIVFPVLFGTFNLVYWATYLNREPVL 507

  Fly   445  444
            Human   508  507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12344NP_001286298.1 LIC 8..441 CDD:273305 129/508 (25%)
GABRA2NP_001317619.1 LIC 25..500 CDD:273305 127/496 (26%)
LGIC_ECD_GABAAR_A2 47..249 CDD:349836 55/215 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1057372at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.