DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12344 and GABRA1

DIOPT Version :9

Sequence 1:NP_001286298.1 Gene:CG12344 / 36145 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_000797.2 Gene:GABRA1 / 2554 HGNCID:4075 Length:456 Species:Homo sapiens


Alignment Length:441 Identity:124/441 - (28%)
Similarity:202/441 - (45%) Gaps:61/441 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NYTAKPRVV--LPPNYVKEIRPP-SKKGSPVIVDFSIFVVDINSINVEDMDFRVDMFIHQRWLES 92
            |.|...|::  |...|...:||. .::.:.|..|  |||.....::..||::.:|:|..|.|.:.
Human    38 NTTVFTRILDRLLDGYDNRLRPGLGERVTEVKTD--IFVTSFGPVSDHDMEYTIDVFFRQSWKDE 100

  Fly    93 RLEIPDDIFEEGDDYVTLLPEVF-ENFWQPDPYFLNSK--IAEIATLTHKFTSVTLYKNKTVRYA 154
            ||:.      :|...|..|..:. ...|.||.:|.|.|  :|...|:.:|...:|  ::.|:.|.
Human   101 RLKF------KGPMTVLRLNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRIT--EDGTLLYT 157

  Fly   155 ARMHAIIACQMEFQLYPMDIQVCPIYIESFSSNNQKVKLRW----SDSGVTLNPELKLLQYN-LG 214
            .|:.....|.|..:.:|||...||:...|::....:|...|    :.|.|......:|.||: ||
Human   158 MRLTVRAECPMHLEDFPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLG 222

  Fly   215 QPLELEESDGYMPEKVGNFSRLTVYFRFERQIGHHLIQTFAPSSLVVMLSWFSFWLGLDAIPGRV 279
            |.::    .|.:....|.:..:|.:|..:|:||:.:|||:.|..:.|:||..||||..:::|.|.
Human   223 QTVD----SGIVQSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPART 283

  Fly   280 TLLVTCMLTLVTMFTGA--DIPPVAYVKALDLWMAGCMLSVFAALAEFVVVKVLDVQ-YQYQVNR 341
            ...||.:||:.|:...|  .:|.|||..|:|.::|.|...||:||.||..|.....: |.:....
Human   284 VFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKS 348

  Fly   342 IPKVLPMRISN--MEKGQ--CATVASW--------EGGAVRSRKATQTPTTPGQTSLQGNGGPPK 394
            :....|.::.:  ::|..  ..|..|:        .|.|..::.||..|     ..::....||:
Human   349 VVPEKPKKVKDPLIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEP-----KEVKPETKPPE 408

  Fly   395 PARRQSLLSVAWTDTDTGVEKIMWREIDKVSRAVFPILFFVFVLLYWPILL 445
            |.:           |...|.|     ||::||..||:||.:|.|:||...|
Human   409 PKK-----------TFNSVSK-----IDRLSRIAFPLLFGIFNLVYWATYL 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12344NP_001286298.1 LIC 8..441 CDD:273305 121/435 (28%)
GABRA1NP_000797.2 LIC 14..442 CDD:273305 123/438 (28%)
LGIC_ECD_GABAAR_A1 56..249 CDD:349835 53/206 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1057372at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.