DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12344 and Gabrg1

DIOPT Version :9

Sequence 1:NP_001286298.1 Gene:CG12344 / 36145 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_034382.2 Gene:Gabrg1 / 14405 MGIID:103156 Length:465 Species:Mus musculus


Alignment Length:434 Identity:110/434 - (25%)
Similarity:189/434 - (43%) Gaps:85/434 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YVKEIRPPSKKGSPVIVDFSIFVVDINSINVEDMDFRVDMFIHQRWLESRLEIPDDIFEEGDDYV 108
            |..::||.... .|.:::..::|..|..::..:|::.:|:...|.|.:|||:     |......:
Mouse    75 YDNKLRPDIGV-RPTVIETDVYVNSIGPVDPINMEYTIDIIFAQTWFDSRLK-----FNSTMKVL 133

  Fly   109 TLLPEVFENFWQPDPYFLNSKIAEIATLTHKFTSVTLYKNKTVRYAARMHAIIACQMEFQLYPMD 173
            .|...:....|.||.:|.||:.::...:|.....:.::.:..|.|..|:.....|.::...:|||
Mouse   134 MLNSNMVGKIWIPDTFFRNSRKSDAHWITTPNRLLRIWSDGRVLYTLRLTINAECYLQLHNFPMD 198

  Fly   174 IQVCPIYIESFSSNNQKVKLRWSDSGVTL-NPEL-KLLQY---NLGQPLELEESDGYMPEKVGNF 233
            ...||:...|:.....:::.:|....|.: :|:. :|.|:   .|....|:..:..      |::
Mouse   199 EHSCPLEFSSYGYPKNEIEYKWKKPSVEVADPKYWRLYQFAFVGLRNSTEISHTIS------GDY 257

  Fly   234 SRLTVYFRFERQIGHHLIQTFAPSSLVVMLSWFSFWLGLDAIPGRVTLLVTCMLTLVTMFTGA-- 296
            ..:|::|...|::|:..|||:.|..|.|:|||.|||:..||:|.|.:|.:|.:||:.|:.|.|  
Mouse   258 IIMTIFFDLSRRMGYFTIQTYIPCILTVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARK 322

  Fly   297 DIPPVAYVKALDLWMAGCMLSVFAALAEFVVVKVLDVQYQYQVNRIPKVLPMRISNMEKGQCATV 361
            .:|.|:||.|:||:::.|.:.|||||.|:..:      :.:..|.                    
Mouse   323 SLPKVSYVTAMDLFVSVCFIFVFAALMEYGTL------HYFTSNN-------------------- 361

  Fly   362 ASWEGGAVRSRK-ATQTPTTPGQTSLQGNGGPPKPARRQSL-------------------LSVAW 406
               :|...|.|| ..:|..:||..:    |....|....||                   ....:
Mouse   362 ---KGKTTRGRKLKNKTSASPGLHA----GSTLIPMNSISLPQGEDDYGYQCLEGKDCTSFFCCF 419

  Fly   407 TDTDTGVEKIMWRE---------IDKVSRAVFPILFFVFVLLYW 441
            .|..||    .|||         ||..||..||..|.:|.|:||
Mouse   420 DDCRTG----SWREGRIHIRIAKIDSYSRIFFPTAFALFNLVYW 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12344NP_001286298.1 LIC 8..441 CDD:273305 108/432 (25%)
Gabrg1NP_034382.2 Neur_chan_LBD 65..270 CDD:280998 43/206 (21%)
LIC 66..462 CDD:273305 110/434 (25%)
Neur_chan_memb 277..459 CDD:280999 62/218 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.