DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12344 and Gabra3

DIOPT Version :9

Sequence 1:NP_001286298.1 Gene:CG12344 / 36145 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster
Sequence 2:NP_001344745.1 Gene:Gabra3 / 14396 MGIID:95615 Length:523 Species:Mus musculus


Alignment Length:468 Identity:125/468 - (26%)
Similarity:202/468 - (43%) Gaps:96/468 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 NYTAKPRVV--LPPNYVKEIRPPSKKGSPVI-VDFSIFVVDINSINVEDMDFRVDMFIHQRWLES 92
            |.|...|::  |...|...:||  ..|..|. |...|:|.....::..||::.:|:|..|.|.:.
Mouse    94 NITIFTRILDRLLDGYDNRLRP--GLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDE 156

  Fly    93 RLEIPDDIFEEGDDYVTLLP---EVFENFWQPDPYFLNSKIAEIATLTHKFTS----VTLYKNKT 150
            ||:.        |..:.:||   .:....|.||.:|.|.|    .::.|..|:    :.|..|.|
Mouse   157 RLKF--------DGPMKILPLNNLLASKIWTPDTFFHNGK----KSVAHNMTTPNKLLRLVDNGT 209

  Fly   151 VRYAARMHAIIACQMEFQLYPMDIQVCPIYIESFSSNNQKVKLRWSDSGVTLNPEL-----KLLQ 210
            :.|..|:.....|.|..:.:|||:..||:...|::....:|...|: .|...:.|:     :|.|
Mouse   210 LLYTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTKAEVIYSWT-LGKNKSVEVAQDGSRLNQ 273

  Fly   211 YN-LGQPLELEESDGYMPEKVGNFSRLTVYFRFERQIGHHLIQTFAPSSLVVMLSWFSFWLGLDA 274
            |: ||..:..|    .:....|.:..:|.:|..:|:||:.:|||:.|..:.|:||..||||..::
Mouse   274 YDLLGHVVGTE----IIRSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRES 334

  Fly   275 IPGRVTLLVTCMLTLVTMFTGA--DIPPVAYVKALDLWMAGCMLSVFAALAEFVVVKVLDVQ-YQ 336
            :|.|....||.:||:.|:...|  .:|.|||..|:|.::|.|...||:||.||..|.....: :.
Mouse   335 VPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRSWA 399

  Fly   337 YQVNRIPKVLPMR------------------------------ISNMEKGQCATVASWEGGAVRS 371
            ::..::|:.|.|:                              .|.:.|...|..||....|:.|
Mouse   400 WEGKKVPEALEMKKKTPAAPTKKNTTFNIVGTTYPINLAKDTEFSTISKSAAAPSASSTPTAIAS 464

  Fly   372 RKATQTPTTPGQTSLQGNGGPPKPARRQSLLSVAWTDTDTGVEKIMWREIDKVSRAVFPILFFVF 436
            .|||....:|.:|.                       |...|.|     :||:||.:||:||.:|
Mouse   465 PKATYVQDSPAETK-----------------------TYNSVSK-----VDKISRIIFPVLFAIF 501

  Fly   437 VLLYWPILLMKSS 449
            .|:||...:.:.|
Mouse   502 NLVYWATYVNRES 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12344NP_001286298.1 LIC 8..441 CDD:273305 122/458 (27%)
Gabra3NP_001344745.1 Neur_chan_LBD 100..509 CDD:332142 122/455 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1057372at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.