DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12344 and gabra6

DIOPT Version :9

Sequence 1:NP_001286298.1 Gene:CG12344 / 36145 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_031754593.1 Gene:gabra6 / 100488862 XenbaseID:XB-GENE-6049732 Length:455 Species:Xenopus tropicalis


Alignment Length:478 Identity:126/478 - (26%)
Similarity:208/478 - (43%) Gaps:81/478 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LMWL-----------SEATEAHMNYTAKPRVV--LPPNYVKEIRPPSKKGSPVI-VDFSIFVVDI 69
            :||:           :..|.|:::.....|::  |...|...:||  ..|.||. |...|:|...
 Frog     5 IMWIYIFLCTGKALGNNITAANLHSENITRILDRLLDGYDNRLRP--SFGGPVTEVKTDIYVTSF 67

  Fly    70 NSINVEDMDFRVDMFIHQRWLESRLEIPDDIFEEGDDYVTLLPEVFENFWQPDPYFLNSKIAEIA 134
            ..::..||::.:|:|..|.|::.||:     |:...:.:.|...:....|.||.:|.|.|    .
 Frog    68 GPVSDVDMEYTMDIFFRQTWVDERLK-----FDGPTEILRLNNLMVSKIWTPDTFFRNGK----K 123

  Fly   135 TLTHKFTS----VTLYKNKTVRYAARMHAIIACQMEFQLYPMDIQVCPIYIESFSSNNQKVKLRW 195
            ::.|..|:    ..:.:|.||.|..|:.....|.|....:|||...||:...|::....::...|
 Frog   124 SIAHNMTTPNKLFRIMQNGTVLYTMRLTIKAECPMRLMNFPMDGHACPLKFGSYAYPKSEIVYTW 188

  Fly   196 SDSGVTLNPEL-----KLLQYNL-GQPLELEESDGYMPEKVGNFSRLTVYFRFERQIGHHLIQTF 254
            . .|...:.|:     .||||:| ||.:..|.    :....|.:|...|.|..:|:||:::|.|:
 Frog   189 K-KGPLYSVEVPEESSSLLQYDLVGQKVSSET----LLSNTGEYSLQVVMFFLQRKIGYYIIHTY 248

  Fly   255 APSSLVVMLSWFSFWLGLDAIPGRVTLLVTCMLTLVTMFTGA--DIPPVAYVKALDLWMAGCMLS 317
            .|.|:.|:||...||:..:::|.|....:|.:||:.|:...|  ..|.|:|..|:|.::|.|...
 Frog   249 IPCSMTVVLSQVVFWINKESVPARTVAGITTVLTMTTLSISARHSFPKVSYATAMDWFIAVCFAF 313

  Fly   318 VFAALAEFVVVKVLDVQYQYQVNRIPKVLPMRISNMEKGQCATVASWEGGAVRS----------- 371
            ||:||.||..|       .|..|     |.::.:.|:..:.|.:|:....|...           
 Frog   314 VFSALIEFAAV-------NYFTN-----LQIQKTMMKAAKKAALAAATARAENEFVTLSDSNCNL 366

  Fly   372 RKATQTPTTPGQTSLQG----------NGGPPKPARRQSLLSVAWTDTDTGVEKIMWREIDKVSR 426
            :|...:..:.|..|.:|          |.....|. |..:||...:...||..|     |||.:|
 Frog   367 KKRINSVASQGNQSTEGDLPLYEDSPYNEQTDIPT-RDHMLSDTTSSQHTGTSK-----IDKYAR 425

  Fly   427 AVFPILFFVFVLLYWPILLMKSS 449
            .:||:.|..|.|:||.:.|.|.:
 Frog   426 ILFPLSFAGFNLVYWVVYLSKDT 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12344NP_001286298.1 LIC 8..441 CDD:273305 122/468 (26%)
gabra6XP_031754593.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1057372at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.