DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12344 and LOC100333913

DIOPT Version :9

Sequence 1:NP_001286298.1 Gene:CG12344 / 36145 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_002666117.5 Gene:LOC100333913 / 100333913 -ID:- Length:175 Species:Danio rerio


Alignment Length:172 Identity:50/172 - (29%)
Similarity:72/172 - (41%) Gaps:31/172 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 LTLVTMFTGADIPPVAYVKALDLWMAGCMLSVFAALAEFVVVKVL-------DVQYQYQVNR--- 341
            :|.:::.....:|.|||..|:|.:||.|...||:||.||..|...       |.|.:.|..|   
Zfish     1 MTTLSISARNSLPKVAYATAMDWFMAVCYAFVFSALIEFATVNYFTKRSWAWDGQKEAQEMRRRE 65

  Fly   342 ---IPKVLPMRISNMEKGQCATVASWEGGAVRSRKATQTPTTPGQ----TSLQGNGGPPKPARRQ 399
               ..|......:.:......:|....|....|:.||.|.:||.|    ..|....|...|..|:
Zfish    66 SASFSKKTNNTFNIVGTTYSMSVVKDPGLTTISKSATPTTSTPPQPVREVRLPKMDGEYVPEGRK 130

  Fly   400 SLLSVAWTDTDTGVEKIMWREIDKVSRAVFPILFFVFVLLYW 441
            |...|:              ::||:||.:||:|||:|.|.||
Zfish   131 SYNRVS--------------KVDKISRIIFPVLFFIFNLGYW 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12344NP_001286298.1 LIC 8..441 CDD:273305 48/170 (28%)
LOC100333913XP_002666117.5 Neur_chan_memb 1..158 CDD:308533 48/170 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1057372at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.