DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12344 and LOC100001259

DIOPT Version :9

Sequence 1:NP_001286298.1 Gene:CG12344 / 36145 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster
Sequence 2:XP_021336767.1 Gene:LOC100001259 / 100001259 -ID:- Length:369 Species:Danio rerio


Alignment Length:387 Identity:110/387 - (28%)
Similarity:178/387 - (45%) Gaps:39/387 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLDKFNTNAFISFGLGFILMWLSEATEAHM-------NYTAKPRVV--LPPNYVKEIRPPSKKGS 56
            |.::|..:..: |.|  .|.|.:.:..|..       |.|...|::  |...|...:||  ..|.
Zfish     1 MRERFAVHLLV-FAL--TLFWHTRSVSADATTDAFKNNITLFTRILDRLLDGYDNRLRP--GLGD 60

  Fly    57 PV-IVDFSIFVVDINSINVEDMDFRVDMFIHQRWLESRLEIPDDIFEEGDDYVTLLPEVFENFWQ 120
            .| .|...|:|.....::..||::.:|:|..|.|.:.||:     ||...:.:.|...:....|.
Zfish    61 RVTTVKTDIYVTSFGPVSDTDMEYTIDVFFRQSWKDERLK-----FEGPMNILRLNNLMASKIWT 120

  Fly   121 PDPYFLNSK--IAEIATLTHKFTSVTLYKNKTVRYAARMHAIIACQMEFQLYPMDIQVCPIYIES 183
            ||.:|.|.|  :|...|:.:|.  :.:..:.|:.|..|:.....|.|..:.:|||...||:...|
Zfish   121 PDTFFHNGKKSVAHNMTMPNKL--LRIQDDGTLLYTMRLTVHAECPMHLEDFPMDFHSCPLKFGS 183

  Fly   184 FSSNNQKVKLRW----SDSGVTLNPELKLLQYN-LGQPLELEESDGYMPEKVGNFSRLTVYFRFE 243
            ::....:|...|    |:|.|......:|.||: |||.:..|.    :....|.::.:|.:|..:
Zfish   184 YAYTTTEVTYTWTKNASNSVVVEEESSRLNQYDLLGQTVGNET----IRSSTGEYTVMTAHFHLK 244

  Fly   244 RQIGHHLIQTFAPSSLVVMLSWFSFWLGLDAIPGRVTLLVTCMLTLVTMFTGA--DIPPVAYVKA 306
            |:||:.:|||:.|..:.|:||..||||..:::|.|....||.:||:.|:...|  .:|.|||..|
Zfish   245 RKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATA 309

  Fly   307 LDLWMAGCMLSVFAALAEFVVVKVLDVQ-YQYQVNRIPKVLPMRISNMEKGQCATVASWEGG 367
            :|.::|.|...||:||.||..|.....: :.:....:.....|.|:....|.||.   |.||
Zfish   310 MDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKVMIINQRPAGLCAV---WLGG 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12344NP_001286298.1 LIC 8..441 CDD:273305 108/380 (28%)
LOC100001259XP_021336767.1 Neur_chan_LBD 7..>350 CDD:332142 100/358 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1057372at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.