DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12343 and SYF2

DIOPT Version :9

Sequence 1:NP_610617.1 Gene:CG12343 / 36143 FlyBaseID:FBgn0033556 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_011645.3 Gene:SYF2 / 853030 SGDID:S000003361 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:247 Identity:53/247 - (21%)
Similarity:82/247 - (33%) Gaps:93/247 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EKLAERKARLLDLHKKRQEARTDNHQEVVA------------EDARKKL-----PKN-------- 48
            |||.|.|.:.:|:..|.::......|||.|            .||.:.:     |:.        
Yeast     8 EKLKELKRKRVDVSIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTESPEKEKAFHYTV 72

  Fly    49 -----WEARKRQAEWILADDKARAEAQAAGKDYERL------KLLEVSAVDADRIEKKKKRKDNP 102
                 ||.|..|.:        ..::|..|..|::|      |.|...|.......|:....|..
Yeast    73 QEYDAWERRHPQGK--------TGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEE 129

  Fly   103 DLGFSTYEAQTARQYNRLVKSMPARDLEKYERQKEELGDAFYGGAHTTLHSRTK-------DTPG 160
            |                 .|::|         :|..:|         .:...||       |...
Yeast   130 D-----------------NKNVP---------KKGRIG---------KVQKDTKTGKITIADDDK 159

  Fly   161 AINKMVTDLEQQIERRKKYSRRRIYNDDADV-----DFINERNSKFNKKLDR 207
            .:||:...|  |.|.:|:|..|:....:|..     .|||::|.:||:||.|
Yeast   160 LVNKLAVSL--QSESKKRYEARKRQMQNAKTLYGVESFINDKNKQFNEKLSR 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12343NP_610617.1 SYF2 71..221 CDD:285444 34/155 (22%)
SYF2NP_011645.3 SYF2 60..209 CDD:400506 39/193 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2609
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103856
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.800

Return to query results.
Submit another query.