DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12343 and Syf2

DIOPT Version :9

Sequence 1:NP_610617.1 Gene:CG12343 / 36143 FlyBaseID:FBgn0033556 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_081056.1 Gene:Syf2 / 68592 MGIID:1915842 Length:242 Species:Mus musculus


Alignment Length:220 Identity:125/220 - (56%)
Similarity:165/220 - (75%) Gaps:2/220 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AAEKLAERKARLLDLHKKRQEARTDNHQEVVAEDARKKLPKNWEARKRQAEWILADDKARAEAQA 71
            ||:|..:|..:..:||.||.|||..||||||.||.|.|||.||||:|.:.||.|.:::.:.|..|
Mouse    25 AAQKREQRLRKFRELHLKRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELQEEEKKKECAA 89

  Fly    72 AGKDYERLKLLEVSAVDADRIEKKKKRKDNPDLGFSTYEAQTARQYNRLVKSMPARDLEKYERQK 136
            .|:|||::||||:||.||:|.|::||:| |||||||.|.|...|||:||.|.:.. |:|.||||:
Mouse    90 RGEDYEKVKLLEISAEDAERWERRKKKK-NPDLGFSDYAAAQLRQYHRLTKQIKP-DMESYERQR 152

  Fly   137 EELGDAFYGGAHTTLHSRTKDTPGAINKMVTDLEQQIERRKKYSRRRIYNDDADVDFINERNSKF 201
            |:.|:.|:..:::.||.....:...|::||.|||:|||:|.||||||.||||||:|:|||||:||
Mouse   153 EKHGEDFFPTSNSLLHGTHVPSSEEIDRMVLDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKF 217

  Fly   202 NKKLDRFYSEHTAEIKQNLERGTAI 226
            |||.:|||.::|||||||||||||:
Mouse   218 NKKAERFYGKYTAEIKQNLERGTAV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12343NP_610617.1 SYF2 71..221 CDD:285444 87/149 (58%)
Syf2NP_081056.1 SYF2 89..237 CDD:400506 87/149 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836069
Domainoid 1 1.000 177 1.000 Domainoid score I3578
eggNOG 1 0.900 - - E1_KOG2609
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5993
Inparanoid 1 1.050 250 1.000 Inparanoid score I3216
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55400
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004947
OrthoInspector 1 1.000 - - oto92947
orthoMCL 1 0.900 - - OOG6_103856
Panther 1 1.100 - - LDO PTHR13264
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1436
SonicParanoid 1 1.000 - - X3486
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.