DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12343 and syf2

DIOPT Version :9

Sequence 1:NP_610617.1 Gene:CG12343 / 36143 FlyBaseID:FBgn0033556 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_017950121.1 Gene:syf2 / 496706 XenbaseID:XB-GENE-920839 Length:256 Species:Xenopus tropicalis


Alignment Length:220 Identity:127/220 - (57%)
Similarity:161/220 - (73%) Gaps:2/220 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AAEKLAERKARLLDLHKKRQEARTDNHQEVVAEDARKKLPKNWEARKRQAEWILADDKARAEAQA 71
            ||:|...|..:..:||.|..|||..||||||.||.|:|||.||||||.:.||.|.:::.:.|..|
 Frog    39 AAQKREARLRKFRELHLKTNEARKLNHQEVVEEDKRQKLPSNWEARKARLEWELKEEEKKRECAA 103

  Fly    72 AGKDYERLKLLEVSAVDADRIEKKKKRKDNPDLGFSTYEAQTARQYNRLVKSMPARDLEKYERQK 136
            .|.||||.||||:||.||:|.|:||||| |||||||.|.|...|||.||.|.:.. |:|:||.:|
 Frog   104 NGVDYERAKLLEISAEDAERWERKKKRK-NPDLGFSDYAAAQLRQYQRLTKQIKP-DMEEYEMEK 166

  Fly   137 EELGDAFYGGAHTTLHSRTKDTPGAINKMVTDLEQQIERRKKYSRRRIYNDDADVDFINERNSKF 201
            ::.|:.||..:.:..|.....:...|::||||||:|||:|:||||||.||||||:|:|||||:||
 Frog   167 QKQGEMFYPTSESLYHGTHIPSQSGIDRMVTDLEKQIEKREKYSRRRAYNDDADIDYINERNAKF 231

  Fly   202 NKKLDRFYSEHTAEIKQNLERGTAI 226
            |||.:|||.::|||||||||||||:
 Frog   232 NKKAERFYGKYTAEIKQNLERGTAV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12343NP_610617.1 SYF2 71..221 CDD:285444 89/149 (60%)
syf2XP_017950121.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 180 1.000 Domainoid score I3450
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5993
Inparanoid 1 1.050 252 1.000 Inparanoid score I3134
OMA 1 1.010 - - QHG55400
OrthoDB 1 1.010 - - D1565402at2759
OrthoFinder 1 1.000 - - FOG0004947
OrthoInspector 1 1.000 - - oto103212
Panther 1 1.100 - - LDO PTHR13264
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1436
SonicParanoid 1 1.000 - - X3486
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.