DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12343 and Syf2

DIOPT Version :9

Sequence 1:NP_610617.1 Gene:CG12343 / 36143 FlyBaseID:FBgn0033556 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_596908.2 Gene:Syf2 / 170933 RGDID:621592 Length:242 Species:Rattus norvegicus


Alignment Length:220 Identity:125/220 - (56%)
Similarity:165/220 - (75%) Gaps:2/220 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AAEKLAERKARLLDLHKKRQEARTDNHQEVVAEDARKKLPKNWEARKRQAEWILADDKARAEAQA 71
            ||:|..:|..:..:||.||.|||..||||||.||.|.|||.||||:|.:.||.|.:::.:.|..|
  Rat    25 AAQKREQRLRKFRELHLKRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELQEEEKKKECAA 89

  Fly    72 AGKDYERLKLLEVSAVDADRIEKKKKRKDNPDLGFSTYEAQTARQYNRLVKSMPARDLEKYERQK 136
            .|:|||::||||:||.||:|.|::||:| |||||||.|.|...|||:||.|.:.. |:|.||||:
  Rat    90 RGEDYEKVKLLEISAEDAERWERRKKKK-NPDLGFSDYAAAQLRQYHRLTKQIKP-DMESYERQR 152

  Fly   137 EELGDAFYGGAHTTLHSRTKDTPGAINKMVTDLEQQIERRKKYSRRRIYNDDADVDFINERNSKF 201
            |:.|:.|:..:::.||.....:...|::||.|||:|||:|.||||||.||||||:|:|||||:||
  Rat   153 EKHGEDFFPTSNSLLHGTHVPSSEEIDRMVLDLEKQIEKRDKYSRRRPYNDDADIDYINERNAKF 217

  Fly   202 NKKLDRFYSEHTAEIKQNLERGTAI 226
            |||.:|||.::|||||||||||||:
  Rat   218 NKKAERFYGKYTAEIKQNLERGTAV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12343NP_610617.1 SYF2 71..221 CDD:285444 87/149 (58%)
Syf2NP_596908.2 SYF2 89..237 CDD:400506 87/149 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339727
Domainoid 1 1.000 177 1.000 Domainoid score I3498
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5993
Inparanoid 1 1.050 250 1.000 Inparanoid score I3150
OMA 1 1.010 - - QHG55400
OrthoDB 1 1.010 - - D1565402at2759
OrthoFinder 1 1.000 - - FOG0004947
OrthoInspector 1 1.000 - - oto96501
orthoMCL 1 0.900 - - OOG6_103856
Panther 1 1.100 - - LDO PTHR13264
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3486
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.