DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15Ab and RPS15AD

DIOPT Version :9

Sequence 1:NP_610616.1 Gene:RpS15Ab / 36142 FlyBaseID:FBgn0033555 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_190190.1 Gene:RPS15AD / 823747 AraportID:AT3G46040 Length:130 Species:Arabidopsis thaliana


Alignment Length:130 Identity:98/130 - (75%)
Similarity:113/130 - (86%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGKIVVNL 65
            |||::||.|.||.:.||||||||||::||.||||||||.||.|||||||||.|:|||:|||||.|
plant     1 MVRISVLNDGLKSMYNAEKRGKRQVMIRPSSKVIIKFLIVMQKHGYIGEFEYVDDHRSGKIVVEL 65

  Fly    66 TGRLNKCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRKHLGGKILGFFF 130
            .||||||||||||||..:.:||.||..||||||||::|||||.|||||||||||::|||:||||:
plant    66 NGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGFIVLTTSAGIMDHEEARRKNVGGKVLGFFY 130

  Fly   131  130
            plant   131  130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15AbNP_610616.1 PTZ00158 1..130 CDD:185487 97/128 (76%)
RPS15ADNP_190190.1 PLN00146 1..130 CDD:215075 97/128 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 205 1.000 Domainoid score I829
eggNOG 1 0.900 - - E1_COG0096
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 213 1.000 Inparanoid score I1241
OMA 1 1.010 - - QHG62199
OrthoDB 1 1.010 - - D1417658at2759
OrthoFinder 1 1.000 - - FOG0001025
OrthoInspector 1 1.000 - - mtm1193
orthoMCL 1 0.900 - - OOG6_100322
Panther 1 1.100 - - O PTHR11758
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X687
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.