DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15Ab and Rps15a

DIOPT Version :9

Sequence 1:NP_610616.1 Gene:RpS15Ab / 36142 FlyBaseID:FBgn0033555 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_733769.1 Gene:Rps15a / 267019 MGIID:2389091 Length:130 Species:Mus musculus


Alignment Length:130 Identity:114/130 - (87%)
Similarity:123/130 - (94%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGKIVVNL 65
            ||||||||||||.|||||||||||||:|||||||::||||||||||||||||::|||||||||||
Mouse     1 MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNL 65

  Fly    66 TGRLNKCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRKHLGGKILGFFF 130
            |||||||||||||||..:.|:|||.||||||||||::|||||.||||||||||||.|||||||||
Mouse    66 TGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKHTGGKILGFFF 130

  Fly   131  130
            Mouse   131  130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15AbNP_610616.1 PTZ00158 1..130 CDD:185487 112/128 (88%)
Rps15aNP_733769.1 PTZ00158 1..130 CDD:185487 112/128 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846003
Domainoid 1 1.000 232 1.000 Domainoid score I2406
eggNOG 1 0.900 - - E1_COG0096
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128982
Inparanoid 1 1.050 244 1.000 Inparanoid score I3278
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62199
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001025
OrthoInspector 1 1.000 - - otm43683
orthoMCL 1 0.900 - - OOG6_100322
Panther 1 1.100 - - O PTHR11758
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2269
SonicParanoid 1 1.000 - - X687
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.