DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15Ab and rps2202

DIOPT Version :9

Sequence 1:NP_610616.1 Gene:RpS15Ab / 36142 FlyBaseID:FBgn0033555 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001342833.1 Gene:rps2202 / 2541977 PomBaseID:SPAC5D6.01 Length:130 Species:Schizosaccharomyces pombe


Alignment Length:130 Identity:91/130 - (70%)
Similarity:105/130 - (80%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGKIVVNL 65
            |||.:||||.|..|.|||:||:||||:||.||||:||||||.|||||.||..::|||:||||:.|
pombe     1 MVRQSVLADCLNNIVNAERRGRRQVLIRPSSKVIVKFLTVMQKHGYIDEFTEIDDHRSGKIVIQL 65

  Fly    66 TGRLNKCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRKHLGGKILGFFF 130
            .||:||||||||||:..:.|||||.|.||||||.|.:|||||.|||.|.|||.|..||||||||:
pombe    66 NGRINKCGVISPRFNVKLKDIEKWVNQLLPSRQVGVIVLTTSRGIMSHNEARAKDAGGKILGFFY 130

  Fly   131  130
            pombe   131  130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15AbNP_610616.1 PTZ00158 1..130 CDD:185487 90/128 (70%)
rps2202NP_001342833.1 PTZ00158 1..130 CDD:185487 90/128 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 186 1.000 Domainoid score I762
eggNOG 1 0.900 - - E1_COG0096
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128982
Inparanoid 1 1.050 194 1.000 Inparanoid score I1029
OMA 1 1.010 - - QHG62199
OrthoFinder 1 1.000 - - FOG0001025
OrthoInspector 1 1.000 - - mtm9309
orthoMCL 1 0.900 - - OOG6_100322
Panther 1 1.100 - - O PTHR11758
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X687
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.