DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15Ab and mrps8

DIOPT Version :9

Sequence 1:NP_610616.1 Gene:RpS15Ab / 36142 FlyBaseID:FBgn0033555 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_587781.1 Gene:mrps8 / 2539594 PomBaseID:SPCC736.10c Length:152 Species:Schizosaccharomyces pombe


Alignment Length:138 Identity:27/138 - (19%)
Similarity:54/138 - (39%) Gaps:35/138 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGKIVVNLTGRLNKCGVISPR------ 78
            |.::.:...|....:::...|:...|::...:..:.| ....:..:|.|.|   |.:.|      
pombe    15 RARKSLASVPNCNSVLELCAVLYHQGFLSSIQRGDIH-GPDALPTITTRQN---VATRRLWLGLK 75

  Fly    79 -FDAP-----INDIEKWTN--NLLPS--------RQFGYV---------VLTTSGGIMDHEEARR 118
             |:..     |..:.|.:.  ||.||        |:..:|         ::.|..|||..::|.:
pombe    76 YFEGKPVLHYIRAVSKPSRKVNLTPSELLQFAKGRKVSFVNGLEPAEVGIVETKHGIMSIDDAIK 140

  Fly   119 KHLGGKIL 126
            .:|||.::
pombe   141 NNLGGNVI 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15AbNP_610616.1 PTZ00158 1..130 CDD:185487 27/138 (20%)
mrps8NP_587781.1 Ribosomal_S8 6..151 CDD:278821 27/138 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0096
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100322
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.