DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15Ab and rps-22

DIOPT Version :9

Sequence 1:NP_610616.1 Gene:RpS15Ab / 36142 FlyBaseID:FBgn0033555 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001379589.1 Gene:rps-22 / 175338 WormBaseID:WBGene00004491 Length:130 Species:Caenorhabditis elegans


Alignment Length:130 Identity:110/130 - (84%)
Similarity:120/130 - (92%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGKIVVNL 65
            |||||||||||..|||||||||||||:||.||||::|||||||||||||||||:|||||||||||
 Worm     1 MVRMNVLADALNAINNAEKRGKRQVLIRPASKVIVRFLTVMMKHGYIGEFEIVDDHRAGKIVVNL 65

  Fly    66 TGRLNKCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRKHLGGKILGFFF 130
            ||||||..|||||.:..:||:||:||.|||||||||::||||.||||||||||||||||||||||
 Worm    66 TGRLNKASVISPRLNIRLNDLEKYTNTLLPSRQFGYLILTTSAGIMDHEEARRKHLGGKILGFFF 130

  Fly   131  130
             Worm   131  130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15AbNP_610616.1 PTZ00158 1..130 CDD:185487 108/128 (84%)
rps-22NP_001379589.1 PTZ00158 1..130 CDD:185487 108/128 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164104
Domainoid 1 1.000 218 1.000 Domainoid score I1527
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128982
Inparanoid 1 1.050 230 1.000 Inparanoid score I2190
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62199
OrthoDB 1 1.010 - - D1417658at2759
OrthoFinder 1 1.000 - - FOG0001025
OrthoInspector 1 1.000 - - otm14442
orthoMCL 1 0.900 - - OOG6_100322
Panther 1 1.100 - - O PTHR11758
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2269
SonicParanoid 1 1.000 - - X687
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.