DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS15Ab and Rps15al4

DIOPT Version :9

Sequence 1:NP_610616.1 Gene:RpS15Ab / 36142 FlyBaseID:FBgn0033555 Length:130 Species:Drosophila melanogaster
Sequence 2:XP_038959454.1 Gene:Rps15al4 / 100361715 RGDID:2319559 Length:130 Species:Rattus norvegicus


Alignment Length:130 Identity:113/130 - (86%)
Similarity:122/130 - (93%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVRMNVLADALKCINNAEKRGKRQVLLRPCSKVIIKFLTVMMKHGYIGEFEIVEDHRAGKIVVNL 65
            ||||||||||||.|||||||||||||:|||||||::|.||||||||||||||::|||||||||||
  Rat     1 MVRMNVLADALKSINNAEKRGKRQVLIRPCSKVIVRFQTVMMKHGYIGEFEIIDDHRAGKIVVNL 65

  Fly    66 TGRLNKCGVISPRFDAPINDIEKWTNNLLPSRQFGYVVLTTSGGIMDHEEARRKHLGGKILGFFF 130
            |||||||||||||||..:.|:|||.||||||||||::|||||.||||||||||||.|||||||||
  Rat    66 TGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKHTGGKILGFFF 130

  Fly   131  130
              Rat   131  130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS15AbNP_610616.1 PTZ00158 1..130 CDD:185487 111/128 (87%)
Rps15al4XP_038959454.1 PTZ00158 1..130 CDD:185487 111/128 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349440
Domainoid 1 1.000 232 1.000 Domainoid score I2326
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 244 1.000 Inparanoid score I3207
OMA 1 1.010 - - QHG62199
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001025
OrthoInspector 1 1.000 - - mtm9122
orthoMCL 1 0.900 - - OOG6_100322
Panther 1 1.100 - - O PTHR11758
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X687
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.900

Return to query results.
Submit another query.