DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsm10 and AT3G07590

DIOPT Version :10

Sequence 1:NP_610615.1 Gene:Lsm10 / 36141 FlyBaseID:FBgn0033554 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_187416.1 Gene:AT3G07590 / 819950 AraportID:AT3G07590 Length:114 Species:Arabidopsis thaliana


Alignment Length:71 Identity:23/71 - (32%)
Similarity:32/71 - (45%) Gaps:6/71 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LQGHSVLIDLHNETSVAGIIDVADGHMTCELTHAVFIDRN-GGQHP--FDHFMVRNRMIRQIHIP 84
            |...:|.|:|.|.|.|.|.|...|..|.   ||...:..: .|::|  .||..:|...||...:|
plant    10 LNNETVSIELKNGTVVHGTITGVDVSMN---THLKTVKMSLKGKNPVTLDHLSLRGNNIRYYILP 71

  Fly    85 SYLDAE 90
            ..|:.|
plant    72 DSLNLE 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lsm10NP_610615.1 LSm10 7..84 CDD:212480 20/63 (32%)
AT3G07590NP_187416.1 Sm_D1 2..92 CDD:212471 23/71 (32%)

Return to query results.
Submit another query.