DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7222 and AT1G47740

DIOPT Version :9

Sequence 1:NP_001286295.1 Gene:CG7222 / 36138 FlyBaseID:FBgn0033551 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001322435.1 Gene:AT1G47740 / 841185 AraportID:AT1G47740 Length:279 Species:Arabidopsis thaliana


Alignment Length:181 Identity:71/181 - (39%)
Similarity:97/181 - (53%) Gaps:14/181 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ELLPSNMGT-REPVILNVYDMYWINEYTTSIGLGVFHSGVEAFGTEFAYGGHPFPFTGVFEISPR 90
            :|..:|.|. |.||.|||||:..||.|....|||:||||||..|.|:|:|.|.:..:||||:.||
plant    58 KLKSNNHGPGRAPVYLNVYDLTPINGYIYWAGLGIFHSGVEVHGVEYAFGAHDYATSGVFEVEPR 122

  Fly    91 DHDELGDQFQFRQSIQIGCTDFTYEEVRRIVEELGNQFRGDRYHLMNNNCNHFSGSLTQILCGQE 155
            .    ...|:|::||.||.|:....:||..:|::...:.|:.|||:..|||||...:...|.|::
plant   123 Q----CPGFKFKKSIFIGTTNLNPTQVREFMEDMACSYYGNMYHLIVKNCNHFCQDVCYKLTGKK 183

  Fly   156 IPSWVNRLAHFS---SCVPFLQRCLPKEWLTPNALQQSITTIQEREDSDNS 203
            ||.||||||...   ||:      ||:..............|.|.|:...|
plant   184 IPKWVNRLAQIGSVCSCI------LPESLKITAVCHDPDGQIPEEENEKRS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7222NP_001286295.1 Peptidase_C97 37..181 CDD:399119 63/146 (43%)
AT1G47740NP_001322435.1 Peptidase_C97 69..206 CDD:399119 63/146 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 129 1.000 Domainoid score I1710
eggNOG 1 0.900 - - E1_KOG0324
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I1889
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300278at2759
OrthoFinder 1 1.000 - - FOG0001883
OrthoInspector 1 1.000 - - mtm967
orthoMCL 1 0.900 - - OOG6_101256
Panther 1 1.100 - - O PTHR12378
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1415
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.