DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7222 and AT5G47310

DIOPT Version :9

Sequence 1:NP_001286295.1 Gene:CG7222 / 36138 FlyBaseID:FBgn0033551 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_199542.1 Gene:AT5G47310 / 834778 AraportID:AT5G47310 Length:245 Species:Arabidopsis thaliana


Alignment Length:201 Identity:71/201 - (35%)
Similarity:107/201 - (53%) Gaps:28/201 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LSFPSCLSVPKDEIGNEELLPSNMGTREPVILNVYDMYWINEYTTSIGLGVFHSGVEAFGTEFAY 74
            ||...|....|:|   ||:  :..|:..||.|||||:..:|.|....|||:||||:||.|.|:.|
plant     6 LSSSLCSGEDKEE---EEI--NGEGSLTPVYLNVYDLTPVNNYLYWFGLGIFHSGIEAHGFEYGY 65

  Fly    75 GGHPFPFTGVFEISPRDHDELGDQFQFRQSIQIGCTDFTYEEVRRIVEELGNQFRGDRYHLMNNN 139
            |.|.:..:||||:.||.    ...|.||:|:.:|.|..:..:.|..:|:|..::.||.|||:..|
plant    66 GAHEYSSSGVFEVEPRS----CPGFIFRRSVLLGTTSMSRSDFRSFMEKLSRKYHGDTYHLIAKN 126

  Fly   140 CNHFSGSLTQILCGQEIPSWVNRLAH---FSSCVPFLQRCLPKEWLTPNALQQSIT----TIQER 197
            ||||:..:...:.|:.||.|:||:|.   |.:|:            .|.::|.|..    .::..
plant   127 CNHFTEEVCLQVTGKPIPGWINRMARVGSFCNCI------------LPESIQLSSVNHPEALEFS 179

  Fly   198 EDSDNS 203
            :|:|.|
plant   180 DDNDGS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7222NP_001286295.1 Peptidase_C97 37..181 CDD:399119 57/146 (39%)
AT5G47310NP_199542.1 Peptidase_C97 28..164 CDD:399119 58/151 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 129 1.000 Domainoid score I1710
eggNOG 1 0.900 - - E1_KOG0324
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56741
Inparanoid 1 1.050 129 1.000 Inparanoid score I1889
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300278at2759
OrthoFinder 1 1.000 - - FOG0001883
OrthoInspector 1 1.000 - - mtm967
orthoMCL 1 0.900 - - OOG6_101256
Panther 1 1.100 - - O PTHR12378
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1415
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.