powered by:
Protein Alignment CG7222 and AT5G11290
DIOPT Version :9
| Sequence 1: | NP_001286295.1 |
Gene: | CG7222 / 36138 |
FlyBaseID: | FBgn0033551 |
Length: | 205 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001331812.1 |
Gene: | AT5G11290 / 831000 |
AraportID: | AT5G11290 |
Length: | 422 |
Species: | Arabidopsis thaliana |
| Alignment Length: | 38 |
Identity: | 12/38 - (31%) |
| Similarity: | 17/38 - (44%) |
Gaps: | 8/38 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 6 LPCNLSFP--------SCLSVPKDEIGNEELLPSNMGT 35
||..|||| |.||..:.:....:|.|::..|
plant 231 LPLVLSFPGGSMRMMDSVLSAKEIQNAGVKLQPADNNT 268
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG7222 | NP_001286295.1 |
Peptidase_C97 |
37..181 |
CDD:399119 |
|
| AT5G11290 | NP_001331812.1 |
DUF247 |
35..410 |
CDD:367352 |
12/38 (32%) |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_101256 |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.
