DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7222 and AT5G11290

DIOPT Version :10

Sequence 1:NP_610613.1 Gene:CG7222 / 36138 FlyBaseID:FBgn0033551 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001331812.1 Gene:AT5G11290 / 831000 AraportID:AT5G11290 Length:422 Species:Arabidopsis thaliana


Alignment Length:38 Identity:12/38 - (31%)
Similarity:17/38 - (44%) Gaps:8/38 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LPCNLSFP--------SCLSVPKDEIGNEELLPSNMGT 35
            ||..||||        |.||..:.:....:|.|::..|
plant   231 LPLVLSFPGGSMRMMDSVLSAKEIQNAGVKLQPADNNT 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7222NP_610613.1 Peptidase_C97 37..181 CDD:461775
AT5G11290NP_001331812.1 DUF247 35..410 CDD:460823 12/38 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.