DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7222 and AT4G25660

DIOPT Version :9

Sequence 1:NP_001286295.1 Gene:CG7222 / 36138 FlyBaseID:FBgn0033551 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_194296.1 Gene:AT4G25660 / 828671 AraportID:AT4G25660 Length:255 Species:Arabidopsis thaliana


Alignment Length:146 Identity:51/146 - (34%)
Similarity:75/146 - (51%) Gaps:28/146 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VILNVYD------------MYWINE-YTTSIGL-GVFHSGVEAFGT-EFAYG----GHPFPFTGV 84
            |:|::||            :..||. :...||| |:|||.::.:|. |::||    |     |||
plant     4 VVLHIYDVTNSGSEKTNNTIVQINRFFKDGIGLGGIFHSAIQVYGNDEWSYGYCEQG-----TGV 63

  Fly    85 FEISPRDHDELGDQFQFRQSIQIGCTDFTYEEVRRIVEELGNQFRGDRYHLMNNNCNHFSGSLTQ 149
            |. .|...:.:   :.:|:.|.:|.||.|...|.:|:.||..::.|..|.|::.|||||...|..
plant    64 FS-CPSGKNPM---YTYREKIVLGKTDCTIFMVNQILRELSREWPGHTYDLLSKNCNHFCDVLCD 124

  Fly   150 ILCGQEIPSWVNRLAH 165
            .|...:||.||||.||
plant   125 RLGVPKIPGWVNRFAH 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7222NP_001286295.1 Peptidase_C97 37..181 CDD:399119 51/146 (35%)
AT4G25660NP_194296.1 Peptidase_C97 2..154 CDD:283538 51/146 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0324
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300278at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12378
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.