DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7222 and AT4G17486

DIOPT Version :9

Sequence 1:NP_001286295.1 Gene:CG7222 / 36138 FlyBaseID:FBgn0033551 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_567528.2 Gene:AT4G17486 / 827462 AraportID:AT4G17486 Length:224 Species:Arabidopsis thaliana


Alignment Length:203 Identity:75/203 - (36%)
Similarity:108/203 - (53%) Gaps:32/203 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LSFPSCLSVPKDEIGNEELLPSNMGTREPVILNVYDMYWINEYTTSIGLGVFHSGVEAFGTEFAY 74
            ||..||.|..:||...|..|       .||.|||||:..:|.|....|:|:||||:||...|:.|
plant     6 LSSSSCSSDERDESSGEAAL-------TPVYLNVYDLTPVNNYLYWFGIGIFHSGIEAHNLEYCY 63

  Fly    75 GGHPFPFTGVFEISPRDHDELGDQFQFRQSIQIGCTDFTYEEVRRIVEELGNQFRGDRYHLMNNN 139
            |.|.:|.:||:|:.||:    ...|.||:|:.:|.|..:..:.|..:|:|..::.||.|||:..|
plant    64 GAHEYPTSGVYEVEPRN----CPGFIFRRSVLLGTTSMSRSDFRSYMEKLSRKYHGDTYHLIAKN 124

  Fly   140 CNHFSGSLTQILCGQEIPSWVNRLAH---FSSCVPFLQRCLPKEWLTPNALQ-QSITTIQER--- 197
            ||||:..:...|.|:.||.|:||||.   |.:|            |.|.::| .:::.:.||   
plant   125 CNHFTEEVCLQLTGKPIPGWINRLARVGSFCNC------------LLPESIQLTAVSALPERLEF 177

  Fly   198 --EDSDNS 203
              ||..||
plant   178 SDEDESNS 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7222NP_001286295.1 Peptidase_C97 37..181 CDD:399119 57/146 (39%)
AT4G17486NP_567528.2 Peptidase_C97 26..162 CDD:399119 59/151 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 129 1.000 Domainoid score I1710
eggNOG 1 0.900 - - E1_KOG0324
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56741
Inparanoid 1 1.050 129 1.000 Inparanoid score I1889
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1300278at2759
OrthoFinder 1 1.000 - - FOG0001883
OrthoInspector 1 1.000 - - mtm967
orthoMCL 1 0.900 - - OOG6_101256
Panther 1 1.100 - - LDO PTHR12378
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1415
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.