DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7222 and Desi2

DIOPT Version :9

Sequence 1:NP_001286295.1 Gene:CG7222 / 36138 FlyBaseID:FBgn0033551 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_077244.1 Gene:Desi2 / 78825 MGIID:1926075 Length:194 Species:Mus musculus


Alignment Length:173 Identity:105/173 - (60%)
Similarity:144/173 - (83%) Gaps:5/173 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 MGTREPVILNVYDMYWINEYTTSIGLGVFHSGVEAFGTEFAYGGHPFPFTGVFEISPRDHDELGD 97
            ||..:.|:||||||||:||||:|||:||||||:|.:|.||||||||:||:|:|||||.:..|||:
Mouse     1 MGANQLVVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGE 65

  Fly    98 QFQFRQSIQIGCTDFTYEEVRRIVEELGNQFRGDRYHLMNNNCNHFSGSLTQILCGQEIPSWVNR 162
            .|:|::::.:|.|||..:::.:||||||.:::|:.||||:.||||||.:|::||||:|||.|:||
Mouse    66 TFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINR 130

  Fly   163 LAHFSSCVPFLQRCLPKEWLTPNALQQSIT-----TIQEREDS 200
            ||:||||:||||.|||||||||.|||.|::     .::|.||:
Mouse   131 LAYFSSCIPFLQSCLPKEWLTPAALQSSVSQELQDELEEAEDA 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7222NP_001286295.1 Peptidase_C97 37..181 CDD:399119 91/143 (64%)
Desi2NP_077244.1 Peptidase_C97 7..149 CDD:368660 91/141 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850056
Domainoid 1 1.000 225 1.000 Domainoid score I2520
eggNOG 1 0.900 - - E1_KOG0324
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56741
Inparanoid 1 1.050 248 1.000 Inparanoid score I3227
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59072
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001883
OrthoInspector 1 1.000 - - oto95070
orthoMCL 1 0.900 - - OOG6_101256
Panther 1 1.100 - - LDO PTHR12378
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R546
SonicParanoid 1 1.000 - - X1415
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.