DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7222 and DESI2

DIOPT Version :9

Sequence 1:NP_001286295.1 Gene:CG7222 / 36138 FlyBaseID:FBgn0033551 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_011542505.1 Gene:DESI2 / 51029 HGNCID:24264 Length:211 Species:Homo sapiens


Alignment Length:172 Identity:99/172 - (57%)
Similarity:138/172 - (80%) Gaps:10/172 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VILNVYDM-----YWINEYTTSIGLGVFHSGVEAFGTEFAYGGHPFPFTGVFEISPRDHDELGDQ 98
            |:|..|.:     ||:||||:|||:||||||:|.:|.||||||||:||:|:|||||.:..|||:.
Human    19 VVLLSYTLKTTFQYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGET 83

  Fly    99 FQFRQSIQIGCTDFTYEEVRRIVEELGNQFRGDRYHLMNNNCNHFSGSLTQILCGQEIPSWVNRL 163
            |:|::::.:|.|||..:::.:||||||.:::|:.||||:.||||||.:|::||||:|||.|:|||
Human    84 FKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRL 148

  Fly   164 AHFSSCVPFLQRCLPKEWLTPNALQQSIT-----TIQEREDS 200
            |:||||:||||.|||||||||.|||.|::     .::|.||:
Human   149 AYFSSCIPFLQSCLPKEWLTPAALQSSVSQELQDELEEAEDA 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7222NP_001286295.1 Peptidase_C97 37..181 CDD:399119 87/146 (60%)
DESI2XP_011542505.1 Peptidase_C97 37..166 CDD:368660 80/128 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159685
Domainoid 1 1.000 225 1.000 Domainoid score I2534
eggNOG 1 0.900 - - E1_KOG0324
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56741
Inparanoid 1 1.050 248 1.000 Inparanoid score I3251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59072
OrthoDB 1 1.010 - - D1300278at2759
OrthoFinder 1 1.000 - - FOG0001883
OrthoInspector 1 1.000 - - oto91484
orthoMCL 1 0.900 - - OOG6_101256
Panther 1 1.100 - - LDO PTHR12378
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R546
SonicParanoid 1 1.000 - - X1415
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.