DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7222 and desi2

DIOPT Version :9

Sequence 1:NP_001286295.1 Gene:CG7222 / 36138 FlyBaseID:FBgn0033551 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001003532.1 Gene:desi2 / 445138 ZFINID:ZDB-GENE-040801-39 Length:196 Species:Danio rerio


Alignment Length:169 Identity:111/169 - (65%)
Similarity:144/169 - (85%) Gaps:5/169 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EPVILNVYDMYWINEYTTSIGLGVFHSGVEAFGTEFAYGGHPFPFTGVFEISPRDHDELGDQFQF 101
            |||||||||||||||:|:|:|:||||||:|.:|.||||||||:||:|:|||:|.|..|||:.|:|
Zfish     4 EPVILNVYDMYWINEFTSSLGIGVFHSGIEIYGREFAYGGHPYPFSGIFEITPGDATELGETFKF 68

  Fly   102 RQSIQIGCTDFTYEEVRRIVEELGNQFRGDRYHLMNNNCNHFSGSLTQILCGQEIPSWVNRLAHF 166
            :::|.:|.||||.|:|.|||||:|.:::|:.||||:.||||||.:|::||||:|||.||||||:|
Zfish    69 KEAIVLGSTDFTEEDVERIVEEMGKEYKGNAYHLMHKNCNHFSSALSEILCGREIPRWVNRLAYF 133

  Fly   167 SSCVPFLQRCLPKEWLTPNALQQSIT-----TIQEREDS 200
            ||||||||.|||||||||.|||.|::     .::|.||:
Zfish   134 SSCVPFLQSCLPKEWLTPAALQSSVSQELQGELEEAEDA 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7222NP_001286295.1 Peptidase_C97 37..181 CDD:399119 99/143 (69%)
desi2NP_001003532.1 Peptidase_C97 4..148 CDD:283538 99/143 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..196 3/14 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595901
Domainoid 1 1.000 233 1.000 Domainoid score I2335
eggNOG 1 0.900 - - E1_KOG0324
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56741
Inparanoid 1 1.050 254 1.000 Inparanoid score I3167
OMA 1 1.010 - - QHG59072
OrthoDB 1 1.010 - - D1300278at2759
OrthoFinder 1 1.000 - - FOG0001883
OrthoInspector 1 1.000 - - otm26411
orthoMCL 1 0.900 - - OOG6_101256
Panther 1 1.100 - - LDO PTHR12378
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R546
SonicParanoid 1 1.000 - - X1415
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.