DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7222 and desi1a

DIOPT Version :9

Sequence 1:NP_001286295.1 Gene:CG7222 / 36138 FlyBaseID:FBgn0033551 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_956994.1 Gene:desi1a / 393673 ZFINID:ZDB-GENE-040426-1657 Length:169 Species:Danio rerio


Alignment Length:124 Identity:36/124 - (29%)
Similarity:56/124 - (45%) Gaps:16/124 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 GVFHSGVEAFGTEFAYGG---HPFPFTGVFEISPRDHDELGDQFQFRQSIQIGCTDFTYEEVRRI 120
            |::|:.:..:|.||.|||   ...|..|.. :.|.|           ..:::|.|:.|.|.....
Zfish    36 GIWHTSIVIYGEEFFYGGAGISSCPPGGTM-LGPPD-----------TVVELGNTEVTEEIFMDY 88

  Fly   121 VEELG-NQFRGDRYHLMNNNCNHFSGSLTQILCGQEIPSWVNRLAHFSSCVPFLQRCLP 178
            :..|| ..:.||:|.|..:|||.|:..:.|.|.|.:||:::..|.......||.|...|
Zfish    89 LSSLGETTYSGDKYRLFEHNCNTFTNEVAQFLTGNKIPTYITDLPSEVLSTPFGQVLRP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7222NP_001286295.1 Peptidase_C97 37..181 CDD:399119 36/124 (29%)
desi1aNP_956994.1 Peptidase_C97 10..150 CDD:283538 36/124 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0324
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.