DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7222 and CG12231

DIOPT Version :9

Sequence 1:NP_001286295.1 Gene:CG7222 / 36138 FlyBaseID:FBgn0033551 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_573390.1 Gene:CG12231 / 32942 FlyBaseID:FBgn0031026 Length:183 Species:Drosophila melanogaster


Alignment Length:153 Identity:77/153 - (50%)
Similarity:108/153 - (70%) Gaps:1/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GNEELLPSNMGTREPVILNVYDMYWINEYTTSIGLGVFHSGVEAFGTEFAYGGHPFPFTGVFEIS 88
            |:.|:...::..||||:||:||:...|.||..:|||||||||:.:|.|:|:.......:|:|||.
  Fly    14 GDREISTEDIEQREPVMLNIYDLSTSNNYTFPLGLGVFHSGVQLYGREYAFLALNLSISGIFEIH 78

  Fly    89 P-RDHDELGDQFQFRQSIQIGCTDFTYEEVRRIVEELGNQFRGDRYHLMNNNCNHFSGSLTQILC 152
            | ...:|||:.|:||:||.:|.||||..||:|::..||.:|||..|||.:.||||||..|..::|
  Fly    79 PCNGQEELGEHFRFRKSILLGYTDFTCAEVKRVINLLGFEFRGTSYHLTSKNCNHFSNCLAHLVC 143

  Fly   153 GQEIPSWVNRLAHFSSCVPFLQR 175
            |::||.||||||:..:|||||:|
  Fly   144 GRKIPRWVNRLAYLITCVPFLER 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7222NP_001286295.1 Peptidase_C97 37..181 CDD:399119 74/140 (53%)
CG12231NP_573390.1 Peptidase_C97 27..168 CDD:283538 74/140 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452782
Domainoid 1 1.000 129 1.000 Domainoid score I1710
eggNOG 1 0.900 - - E1_KOG0324
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I1889
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59072
OrthoDB 1 1.010 - - D1300278at2759
OrthoFinder 1 1.000 - - FOG0001883
OrthoInspector 1 1.000 - - mtm967
orthoMCL 1 0.900 - - OOG6_101256
Panther 1 1.100 - - P PTHR12378
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R546
SonicParanoid 1 1.000 - - X1415
1312.840

Return to query results.
Submit another query.