Sequence 1: | NP_001286295.1 | Gene: | CG7222 / 36138 | FlyBaseID: | FBgn0033551 | Length: | 205 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005261628.1 | Gene: | DESI1 / 27351 | HGNCID: | 24577 | Length: | 209 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 55/200 - (27%) |
---|---|---|---|
Similarity: | 80/200 - (40%) | Gaps: | 59/200 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 PSNMGTREPVILNVYDMYWINEYTTSIGL--------------GVFHSGVEAFGTEFAYGGHPFP 80
Fly 81 FTGVFEISPRDHDELGDQFQFRQSIQIGCTDFTYEEVRRIVEELGNQ-FRGDRYHLMNNNCNHFS 144
Fly 145 GSLTQILCGQEIPSWVNRLAH-------FSSCVPFLQR---------CLPKEWLT-----PNALQ 188
Fly 189 QSITT 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7222 | NP_001286295.1 | Peptidase_C97 | 37..181 | CDD:399119 | 49/174 (28%) |
DESI1 | XP_005261628.1 | Peptidase_C97 | 7..144 | CDD:368660 | 42/153 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0324 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |