DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7222 and desi2l

DIOPT Version :9

Sequence 1:NP_001286295.1 Gene:CG7222 / 36138 FlyBaseID:FBgn0033551 Length:205 Species:Drosophila melanogaster
Sequence 2:XP_031747409.1 Gene:desi2l / 100489116 XenbaseID:XB-GENE-22066171 Length:192 Species:Xenopus tropicalis


Alignment Length:173 Identity:108/173 - (62%)
Similarity:141/173 - (81%) Gaps:5/173 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EPVILNVYDMYWINEYTTSIGLGVFHSGVEAFGTEFAYGGHPFPFTGVFEISPRDHDELGDQFQF 101
            |||||||||||||||||:::|:||||||:|.:|.||||||||:||:|:|||:|.:..|||:.|:|
 Frog     4 EPVILNVYDMYWINEYTSTLGIGVFHSGIEIYGREFAYGGHPYPFSGIFEITPGNAAELGETFKF 68

  Fly   102 RQSIQIGCTDFTYEEVRRIVEELGNQFRGDRYHLMNNNCNHFSGSLTQILCGQEIPSWVNRLAHF 166
            :::|.:|.||||.|::..|:||||.:::|:.||||:.||||||..|.::|||:|||.||||||:|
 Frog    69 KEAIALGTTDFTEEDIDNIMEELGKEYKGNAYHLMHKNCNHFSAVLAEMLCGKEIPRWVNRLAYF 133

  Fly   167 SSCVPFLQRCLPKEWLTPNALQQSITTIQERED-----SDNSP 204
            |||:||||.|||||||.|.|||..|:...:|||     .|:||
 Frog   134 SSCIPFLQSCLPKEWLIPAALQSHISLGLQREDQGDTTDDDSP 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7222NP_001286295.1 Peptidase_C97 37..181 CDD:399119 94/143 (66%)
desi2lXP_031747409.1 Peptidase_C97 4..148 CDD:399119 94/143 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 225 1.000 Domainoid score I2487
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 245 1.000 Inparanoid score I3205
OMA 1 1.010 - - QHG59072
OrthoDB 1 1.010 - - D1300278at2759
OrthoFinder 1 1.000 - - FOG0001883
OrthoInspector 1 1.000 - - oto105256
Panther 1 1.100 - - O PTHR12378
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1415
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.