DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12341 and MAY24

DIOPT Version :9

Sequence 1:NP_610612.1 Gene:CG12341 / 36137 FlyBaseID:FBgn0033550 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_015479.2 Gene:MAY24 / 856276 SGDID:S000006357 Length:140 Species:Saccharomyces cerevisiae


Alignment Length:114 Identity:26/114 - (22%)
Similarity:46/114 - (40%) Gaps:13/114 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SQARLNT-----FREMWYHVFLWALFSSIFIHTCAAVVAFFTLRKHKFGRFFSILILVMGFLSPA 79
            :.::.||     ..::|.....|.|..:...:..|.|.|..|.|| |.|   |:.|.||..|...
Yeast    27 NNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVTAGVYASLTHRK-KAG---SVWIFVMYVLYGG 87

  Fly    80 SSGIISSAVIAF----VHRASSLPMSPIYAMIWGLGQTIVSACLGFTRI 124
            ..|:.:..|:.|    ::|:....||....:...:.|.:....|.::.:
Yeast    88 VQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCCAVVQILFDVVLSYSMV 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12341NP_610612.1 Tmemb_170 24..128 CDD:401996 26/110 (24%)
MAY24NP_015479.2 Tmemb_170 36..134 CDD:401996 24/101 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22779
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.