DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12341 and Tmem170a

DIOPT Version :9

Sequence 1:NP_610612.1 Gene:CG12341 / 36137 FlyBaseID:FBgn0033550 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001128080.1 Gene:Tmem170a / 498953 RGDID:1559505 Length:144 Species:Rattus norvegicus


Alignment Length:105 Identity:55/105 - (52%)
Similarity:72/105 - (68%) Gaps:0/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LNTFREMWYHVFLWALFSSIFIHTCAAVVAFFTLRKHKFGRFFSILILVMGFLSPASSGIISSAV 88
            |.:|.||||.||||||.||:|.|..|.::|.||||.||:|||.|:.||:||.:.|.::||::||.
  Rat    40 LCSFPEMWYGVFLWALMSSVFFHVPAGLLALFTLRHHKYGRFMSVSILLMGIVGPITAGILTSAA 104

  Fly    89 IAFVHRASSLPMSPIYAMIWGLGQTIVSACLGFTRILATL 128
            ||.|:||:...|.|..|:..|.|||.....:.|.|:||||
  Rat   105 IAGVYRAAGKEMIPFEALTLGTGQTFCVVVVSFLRVLATL 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12341NP_610612.1 Tmemb_170 24..128 CDD:401996 53/103 (51%)
Tmem170aNP_001128080.1 Tmemb_170 39..144 CDD:401996 53/103 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 112 1.000 Domainoid score I6089
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12040
Inparanoid 1 1.050 112 1.000 Inparanoid score I4770
OMA 1 1.010 - - QHG48988
OrthoDB 1 1.010 - - D1545489at2759
OrthoFinder 1 1.000 - - FOG0002648
OrthoInspector 1 1.000 - - otm44903
orthoMCL 1 0.900 - - OOG6_106018
Panther 1 1.100 - - LDO PTHR22779
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2017
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.980

Return to query results.
Submit another query.