DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12341 and F43G9.13

DIOPT Version :9

Sequence 1:NP_610612.1 Gene:CG12341 / 36137 FlyBaseID:FBgn0033550 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_492329.1 Gene:F43G9.13 / 172654 WormBaseID:WBGene00009673 Length:143 Species:Caenorhabditis elegans


Alignment Length:111 Identity:39/111 - (35%)
Similarity:57/111 - (51%) Gaps:0/111 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LRSQARLNTFREMWYHVFLWALFSSIFIHTCAAVVAFFTLRKHKFGRFFSILILVMGFLSPASSG 82
            |.|...:|.:.|:...:|||...|.:.|...|.:::.||||||.:..|..|..::|.|:.|...|
 Worm    33 LLSGKYMNDWWEITLSIFLWMSLSFMVISLGATILSLFTLRKHPYVCFIPIPFIIMMFIIPFVFG 97

  Fly    83 IISSAVIAFVHRASSLPMSPIYAMIWGLGQTIVSACLGFTRILATL 128
            ..:|.|:|....||...:|..|..|.|:.||::......|||.|||
 Worm    98 APTSMVLALAMYASKNAVSTWYCAIMGIIQTLLIFVTSVTRIHATL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12341NP_610612.1 Tmemb_170 24..128 CDD:401996 35/103 (34%)
F43G9.13NP_492329.1 Tmemb_170 41..139 CDD:287199 31/97 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157443
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4349
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I3986
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1545489at2759
OrthoFinder 1 1.000 - - FOG0002648
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106018
Panther 1 1.100 - - LDO PTHR22779
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.