DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12341 and tmem170b

DIOPT Version :9

Sequence 1:NP_610612.1 Gene:CG12341 / 36137 FlyBaseID:FBgn0033550 Length:128 Species:Drosophila melanogaster
Sequence 2:XP_017950518.1 Gene:tmem170b / 100487828 XenbaseID:XB-GENE-6032625 Length:132 Species:Xenopus tropicalis


Alignment Length:105 Identity:47/105 - (44%)
Similarity:75/105 - (71%) Gaps:0/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LNTFREMWYHVFLWALFSSIFIHTCAAVVAFFTLRKHKFGRFFSILILVMGFLSPASSGIISSAV 88
            |.:..||||.|||||||||:|:|..|.|:.|..|::||.||..|:.:.|:|||:.....:|:||.
 Frog    28 LKSLTEMWYWVFLWALFSSLFVHGAAGVLMFVMLQRHKQGRLISVFLGVIGFLASVIGAMITSAA 92

  Fly    89 IAFVHRASSLPMSPIYAMIWGLGQTIVSACLGFTRILATL 128
            :|.::|.:...|:|:.|:::|:|||:::..:.|:|:||||
 Frog    93 VAGIYRVAGKNMAPLEALVFGIGQTVLTVIISFSRVLATL 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12341NP_610612.1 Tmemb_170 24..128 CDD:401996 45/103 (44%)
tmem170bXP_017950518.1 Tmemb_170 28..132 CDD:370871 45/103 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1545489at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.