DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12341 and tmem170a

DIOPT Version :9

Sequence 1:NP_610612.1 Gene:CG12341 / 36137 FlyBaseID:FBgn0033550 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001107395.1 Gene:tmem170a / 100135226 XenbaseID:XB-GENE-955221 Length:142 Species:Xenopus tropicalis


Alignment Length:108 Identity:58/108 - (53%)
Similarity:76/108 - (70%) Gaps:0/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QARLNTFREMWYHVFLWALFSSIFIHTCAAVVAFFTLRKHKFGRFFSILILVMGFLSPASSGIIS 85
            :|.|.:|.||||.||||||.||:|.|..|.::|.||||.||:|||.|:.||:||.|.|.|:||::
 Frog    35 RATLCSFPEMWYGVFLWALVSSLFFHIPAGLLALFTLRHHKYGRFMSVGILLMGILGPISAGILT 99

  Fly    86 SAVIAFVHRASSLPMSPIYAMIWGLGQTIVSACLGFTRILATL 128
            ||.||.|::|:...|.|..|::.|:|||.....:.|.||||||
 Frog   100 SAAIAGVYKAAGKEMIPFEALVLGVGQTFCVLIVSFLRILATL 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12341NP_610612.1 Tmemb_170 24..128 CDD:401996 55/103 (53%)
tmem170aNP_001107395.1 Tmemb_170 37..142 CDD:370871 55/104 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6055
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H12040
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1545489at2759
OrthoFinder 1 1.000 - - FOG0002648
OrthoInspector 1 1.000 - - oto102951
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5098
SonicParanoid 1 1.000 - - X2017
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.040

Return to query results.
Submit another query.