DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12341 and TMEM170B

DIOPT Version :9

Sequence 1:NP_610612.1 Gene:CG12341 / 36137 FlyBaseID:FBgn0033550 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001094299.1 Gene:TMEM170B / 100113407 HGNCID:34244 Length:132 Species:Homo sapiens


Alignment Length:105 Identity:46/105 - (43%)
Similarity:75/105 - (71%) Gaps:0/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LNTFREMWYHVFLWALFSSIFIHTCAAVVAFFTLRKHKFGRFFSILILVMGFLSPASSGIISSAV 88
            |....||||.:||||||||:|:|..|.|:.|..|::|:.||..|::.:.:|||:..:..:|:||.
Human    28 LRNLTEMWYWIFLWALFSSLFVHGAAGVLMFVMLQRHRQGRVISVIAVSIGFLASVTGAMITSAA 92

  Fly    89 IAFVHRASSLPMSPIYAMIWGLGQTIVSACLGFTRILATL 128
            :|.::|.:...|:|:.|::||:|||:::..:.|:||||||
Human    93 VAGIYRVAGKNMAPLEALVWGVGQTVLTLIISFSRILATL 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12341NP_610612.1 Tmemb_170 24..128 CDD:401996 44/103 (43%)
TMEM170BNP_001094299.1 Tmemb_170 28..132 CDD:401996 44/103 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151889
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4349
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48988
OrthoDB 1 1.010 - - D1545489at2759
OrthoFinder 1 1.000 - - FOG0002648
OrthoInspector 1 1.000 - - otm40763
orthoMCL 1 0.900 - - OOG6_106018
Panther 1 1.100 - - O PTHR22779
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5098
SonicParanoid 1 1.000 - - X2017
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.