DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12341 and tmem170b

DIOPT Version :9

Sequence 1:NP_610612.1 Gene:CG12341 / 36137 FlyBaseID:FBgn0033550 Length:128 Species:Drosophila melanogaster
Sequence 2:XP_003200563.2 Gene:tmem170b / 100001035 ZFINID:ZDB-GENE-070705-331 Length:151 Species:Danio rerio


Alignment Length:120 Identity:49/120 - (40%)
Similarity:83/120 - (69%) Gaps:2/120 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TIADVMGL--RSQARLNTFREMWYHVFLWALFSSIFIHTCAAVVAFFTLRKHKFGRFFSILILVM 73
            ::..|:.|  :.:|.|..|.||||.||||.||||:|:|:...::...||::||.||..:::::.:
Zfish    32 SVQQVLSLWVQGEATLKHFTEMWYWVFLWCLFSSLFVHSAVGLLMCVTLQRHKRGRLITLVLISV 96

  Fly    74 GFLSPASSGIISSAVIAFVHRASSLPMSPIYAMIWGLGQTIVSACLGFTRILATL 128
            |||:....|:|:||.:|.|:|.:...|:|:.|:::|:|||.::..:.|:||||||
Zfish    97 GFLASLGGGVITSAAVAVVYRVAGKDMAPLEALVYGVGQTALTVIISFSRILATL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12341NP_610612.1 Tmemb_170 24..128 CDD:401996 44/103 (43%)
tmem170bXP_003200563.2 Tmemb_170 46..151 CDD:313428 44/104 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586480
Domainoid 1 1.000 108 1.000 Domainoid score I6387
eggNOG 1 0.900 - - E1_KOG4349
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4853
OMA 1 1.010 - - QHG48988
OrthoDB 1 1.010 - - D1545489at2759
OrthoFinder 1 1.000 - - FOG0002648
OrthoInspector 1 1.000 - - otm25523
orthoMCL 1 0.900 - - OOG6_106018
Panther 1 1.100 - - O PTHR22779
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5098
SonicParanoid 1 1.000 - - X2017
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.