DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amfr and HRT1

DIOPT Version :9

Sequence 1:XP_038954087.1 Gene:Amfr / 361367 RGDID:1311551 Length:643 Species:Rattus norvegicus
Sequence 2:NP_014508.1 Gene:HRT1 / 853986 SGDID:S000005493 Length:121 Species:Saccharomyces cerevisiae


Alignment Length:95 Identity:25/95 - (26%)
Similarity:37/95 - (38%) Gaps:27/95 - (28%)


- Green bases have known domain annotations that are detailed below.


  Rat   307 RRIRRHKNYLRVVGNMEARF------AVA-TAEELAVNNDDCAIC------------------WD 346
            :.|.:..|....|...:.||      ||| .:.::||  |:||||                  .|
Yeast    16 QNIAQSSNQSAPVETKKKRFEIKKWTAVAFWSWDIAV--DNCAICRNHIMEPCIECQPKAMTDTD 78

  Rat   347 SMQAARKLPCGHLFHNSCLRSWLEQDTSCP 376
            :...|....|.|.||..|:..|::...:||
Yeast    79 NECVAAWGVCNHAFHLHCINKWIKTRDACP 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmfrXP_038954087.1 HRD1 86..>382 CDD:227568 25/95 (26%)
RING-H2_AMFR 339..382 CDD:319369 15/56 (27%)
CUE_AMFR 458..498 CDD:270604
G2BR 575..600 CDD:375868
HRT1NP_014508.1 APC11 33..121 CDD:227521 22/78 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.