DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amfr and APC11

DIOPT Version :9

Sequence 1:XP_038954087.1 Gene:Amfr / 361367 RGDID:1311551 Length:643 Species:Rattus norvegicus
Sequence 2:NP_010276.3 Gene:APC11 / 851554 SGDID:S000002166 Length:165 Species:Saccharomyces cerevisiae


Alignment Length:116 Identity:32/116 - (27%)
Similarity:45/116 - (38%) Gaps:40/116 - (34%)


- Green bases have known domain annotations that are detailed below.


  Rat   329 ATAEELAVNNDD---------CAIC---WDSMQAARKLP----------CGHLFHNSCLRSWLEQ 371
            :|::|.|.|||.         |.||   ::....:.|.|          |.|.||:.|:..||:.
Yeast    20 STSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDT 84

  Rat   372 DTS---CPTCRMSLNIADG---------------SRAREDHQGENLDENLV 404
            .||   ||.||.:..:..|               ||.||:...|.:.|..|
Yeast    85 PTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSRRREEMIEEGVAEEFV 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmfrXP_038954087.1 HRD1 86..>382 CDD:227568 24/77 (31%)
RING-H2_AMFR 339..382 CDD:319369 19/67 (28%)
CUE_AMFR 458..498 CDD:270604
G2BR 575..600 CDD:375868
APC11NP_010276.3 zf-ANAPC11 1..102 CDD:403920 24/81 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.