DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amfr and SPAP32A8.03c

DIOPT Version :9

Sequence 1:XP_038954087.1 Gene:Amfr / 361367 RGDID:1311551 Length:643 Species:Rattus norvegicus
Sequence 2:NP_594179.1 Gene:SPAP32A8.03c / 2542072 PomBaseID:SPAP32A8.03c Length:513 Species:Schizosaccharomyces pombe


Alignment Length:131 Identity:34/131 - (25%)
Similarity:51/131 - (38%) Gaps:35/131 - (26%)


- Green bases have known domain annotations that are detailed below.


  Rat   332 EELAVNNDDCAICWDSMQA---ARKLPCGHLFHNSCLRSWLEQDTSCPTCRMSLNIADGSRARED 393
            :||.....:|.||.:..:.   ..:|||.|.||.:|::.||..:.:|..||..::  ..|:.|.:
pombe   387 KELIDEEGECTICMEMFKINDDVIQLPCKHYFHENCIKPWLRVNGTCAICRAPVD--PNSQQRNN 449

  Rat   394 HQGENLDENLVPVAAAEGRPRLNQHNHFFHFDGSRIASWLPSFSVEVMHTTNILGITQASNSQLN 458
            ...::                .|.||...|.:        ||.|     |||..|.| ..|...|
pombe   450 TSTDS----------------ANGHNPSNHAN--------PSTS-----TTNDQGAT-LRNESFN 484

  Rat   459 A 459
            |
pombe   485 A 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmfrXP_038954087.1 HRD1 86..>382 CDD:227568 17/52 (33%)
RING-H2_AMFR 339..382 CDD:319369 15/45 (33%)
CUE_AMFR 458..498 CDD:270604 2/2 (100%)
G2BR 575..600 CDD:375868
SPAP32A8.03cNP_594179.1 HypA <1..34 CDD:302785
zf-RING_2 394..437 CDD:290367 13/42 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.