DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Amfr and SPBC2A9.04c

DIOPT Version :9

Sequence 1:XP_038954087.1 Gene:Amfr / 361367 RGDID:1311551 Length:643 Species:Rattus norvegicus
Sequence 2:NP_596213.1 Gene:SPBC2A9.04c / 2540480 PomBaseID:SPBC2A9.04c Length:741 Species:Schizosaccharomyces pombe


Alignment Length:318 Identity:71/318 - (22%)
Similarity:108/318 - (33%) Gaps:96/318 - (30%)


- Green bases have known domain annotations that are detailed below.


  Rat   336 VNNDD-----CAICWDSM-----QAARKLPCGHLFHNSCLRSWLEQDTSCPTCRMS--------- 381
            ::||.     |.||:|.|     :.|.|:||||:|..:||:.|||...:||.||..         
pombe    97 LSNDQLMDLTCPICYDDMNENDEKQATKMPCGHIFGKNCLQKWLENHCTCPLCRKEVPHETVGSA 161

  Rat   382 ----LNIADGSRAREDHQGENLDENLVPVAAAEGRPRLNQHNHFFHFDGSRIASWLPSFSVEVMH 442
                |.|...|.....:||.        .|.::.......|:.|.           ||..:...:
pombe   162 HPPILFIIPHSHTLRGNQGN--------TAVSQENASNGVHSDFH-----------PSEELNNAN 207

  Rat   443 TTNILGITQASNSQLNAMAHQIQEMFPQVPYHLVLQDLQMTRSVEITTDNILEGRIQVPFPVQRS 507
            |....|:.:.:. ||:.:|      |.::.:.|.     ..||...|             ||:.:
pombe   208 TDGRTGVDEPAR-QLHRIA------FNRIRFILA-----PNRSATNT-------------PVENT 247

  Rat   508 DSLRPALNS--------PVERPGTDLEEGEASVQTERVPLDLSPRLEETLDFSEVELEPVEVEDF 564
            ....|..|:        |:...|..::...||.:.|..|.|..|....:|              |
pombe   248 HPENPDSNTSTPTTRSEPLAGEGASIDAENASSRQETTPSDSRPSTLTSL--------------F 298

  Rat   565 EARGSRFSKSADERQRMLVQRKDDLLQQARKRFLNKSSEDDGASERLLPSEGTSSDPV 622
            .|    |..|..:|.........:|...:.. ..|.:|.|...|.  |||:...:.||
pombe   299 NA----FFSSMPDRPSSNEPMTSNLTSNSGS-MTNSTSTDLPTSN--LPSQNAPARPV 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AmfrXP_038954087.1 HRD1 86..>382 CDD:227568 23/68 (34%)
RING-H2_AMFR 339..382 CDD:319369 22/65 (34%)
CUE_AMFR 458..498 CDD:270604 6/39 (15%)
G2BR 575..600 CDD:375868 2/24 (8%)
SPBC2A9.04cNP_596213.1 zf-RING_2 106..150 CDD:290367 19/43 (44%)
TFIIA 348..>609 CDD:281188 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.