DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mms4 and EME1B

DIOPT Version :9

Sequence 1:NP_610611.1 Gene:mms4 / 36136 FlyBaseID:FBgn0033549 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_179804.5 Gene:EME1B / 816748 AraportID:AT2G22140 Length:551 Species:Arabidopsis thaliana


Alignment Length:340 Identity:64/340 - (18%)
Similarity:124/340 - (36%) Gaps:73/340 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SNKVDKLHKQALREQQKRIKPGE-CMKYVRMVIDAGFLGIPVGQEALQQLNATGLKYEIRSLPVS 65
            ::|.::..::.|.:::|:.:.|: .:|.:...||...|...:|...|.:.:..|:...:...|:.
plant   226 ASKAEEAERKRLEKEKKKWEKGKLALKSIVAEIDTKVLEGSIGGLLLSRFSEKGITIHVGPNPIE 290

  Fly    66 HCILWERNVGQQTIALGSSPTGLDEAWKSENQVVQWL----SESSFQRAVKDQSLVCLGPRLQDS 126
            ..|:|...:.:....|  .|.|         ..:.:|    ....|...|.:...:.:..|:||.
plant   291 RSIVWTMTIPEDIAPL--FPQG---------PKIPYLLLVYDAEEFCNLVANGKFLEIISRVQDR 344

  Fly   127 FPDCQYTIALPTLRHSKHGSSSSQDALIEMQLLQELHVEQLDQPES-------QDLVALLQRYTK 184
            :|  .||:...|.:              .|..:::...|:...|.:       :.|..|...|.|
plant   345 YP--SYTVCCLTNK--------------LMSYVKKREKEEYKNPGNWRRPPIDEVLAKLTTHYVK 393

  Fly   185 -----AIAEAPYKKQRNETLGGFKKYLAN---DKKQCVRVDQGNG-------------YGRLWQQ 228
                 .:.||    :..|.:.|....||:   .||..:.....||             ....|.:
plant   394 VHSRHCVDEA----EVAEHIVGLTSSLASCQFRKKLTMLSVSANGALVSKDSVDKHLIKKSPWLK 454

  Fly   229 HLNRLPMVTLEVAESIIAQYPCPKKLIDHFSSDPLAVQS----LADLKIKRCNGPQPLHTERRIG 289
            .|..:|.|....|.::..:||..|.|:..:.....:|..    |.|||::...|     .:.|:|
plant   455 ALVAIPKVQPRYALAVWKKYPSMKSLLKVYMDRNKSVHEKEFLLKDLKVEGLVG-----GDIRLG 514

  Fly   290 NVLSNKLYTLYTAKD 304
            .:.|.::|.:..:.|
plant   515 EICSKRIYRVLMSHD 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mms4NP_610611.1 ERCC4 48..179 CDD:280828 21/141 (15%)
EME1BNP_179804.5 XPF_nuclease_EME 253..422 CDD:410859 35/199 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21077
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.