DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mms4 and EME2

DIOPT Version :9

Sequence 1:NP_610611.1 Gene:mms4 / 36136 FlyBaseID:FBgn0033549 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001244299.1 Gene:EME2 / 197342 HGNCID:27289 Length:379 Species:Homo sapiens


Alignment Length:349 Identity:78/349 - (22%)
Similarity:141/349 - (40%) Gaps:79/349 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KQALREQQKRIKPGECMKYVRMVIDAGFL---GIPVGQEALQQLN----------ATGLKYE--- 58
            ::|..|..:.::|.:.:|.:.:.:|...|   |..|..|||:.|.          |..|::.   
Human    57 RRAAAEALRLLRPEQVLKRLAVCVDTAILEDAGADVLMEALEALGCECRIEPQRPARSLRWTRAS 121

  Fly    59 ----IRSLPVSHCILWERNVGQQTIALGSSPTGLDEAWKSENQV------VQWLSESSFQRAVKD 113
                .||||..   :|.  .|:|.:.|...|....:...:..|:      |.|:|..:..|    
Human   122 PDPCPRSLPPE---VWA--AGEQELLLLLEPEEFLQGVATLTQISGPTHWVPWISPETTAR---- 177

  Fly   114 QSLVCLGPRLQDSFPDCQYTIALPTLRHSKHGSSSS-----------------QDALIEMQLLQE 161
            ..|..:|   .|::        |.:.:|...|:...                 ::||:.:||...
Human   178 PHLAVIG---LDAY--------LWSRQHVSRGTQQPESPKVAGAEVAVSWPEVEEALVLLQLWAN 231

  Fly   162 LHVEQLDQPESQDLVALLQRYTKAIAEAPYKKQRNETLGGF---KKYLANDKKQCVRVDQGNGYG 223
            |.|  |.....|:|...:...|||:|:.|.|:.|......|   .::.|.:.   |..| |.|..
Human   232 LDV--LLVASWQELSRHVCAVTKALAQYPLKQYRESQAFSFCTAGRWAAGEP---VARD-GAGLQ 290

  Fly   224 RLWQQHLNRLPMVTLEVAESIIAQYPCPKKL---IDHFSSDPLAVQSLADLKIKRCNGPQPLHTE 285
            ..|::.:.:...|:..||::::..:|.|:.|   ::..|::...:..||||.:....|.:|    
Human   291 AAWRRQIRQFSRVSPAVADAVVTAFPSPRLLQQALEACSTERERMGLLADLPVPPSEGGRP---- 351

  Fly   286 RRIGNVLSNKLYTLYTAKDPNTLI 309
            ||:|..||.::....|..:|:.|:
Human   352 RRVGPDLSRRICLFLTTANPDLLL 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mms4NP_610611.1 ERCC4 48..179 CDD:280828 32/170 (19%)
EME2NP_001244299.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55
ERCC4 <177..249 CDD:280828 16/88 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146905
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5123
Isobase 1 0.950 - 0 Normalized mean entropy S6738
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1595761at2759
OrthoFinder 1 1.000 - - FOG0004634
OrthoInspector 1 1.000 - - otm40418
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21077
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.950

Return to query results.
Submit another query.