DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mms4 and eme2

DIOPT Version :9

Sequence 1:NP_610611.1 Gene:mms4 / 36136 FlyBaseID:FBgn0033549 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_021325918.1 Gene:eme2 / 100332307 ZFINID:ZDB-GENE-121226-1 Length:122 Species:Danio rerio


Alignment Length:138 Identity:30/138 - (21%)
Similarity:62/138 - (44%) Gaps:25/138 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EIRSLPVSHCILWERNVGQQTIALGSSPTGLDEAWKSENQVVQWLSESSFQRAVKDQSLVCLG-P 121
            |:..:..||          :|::..|:|.|  |..:....::|.|.:...:...|..:::.:| .
Zfish     7 ELEDMLSSH----------KTVSNLSAPIG--EIHEGAESLLQHLYKYLSRTEGKVVTILVIGYQ 59

  Fly   122 RLQDSFPDCQYTIALPTLRHSKHGSSSSQDALIEMQLLQELHVEQLD--QPESQDLVALLQRYTK 184
            |...|:.:.:....|     ::| ...:::.|:.:||...:.|..|.  |..:..:||:    ||
Zfish    60 RRSASWDEDELDFQL-----NEH-HMDTEELLVHLQLYWNITVRFLSSWQEVTNHVVAV----TK 114

  Fly   185 AIAEAPYK 192
            |:::.|||
Zfish   115 ALSKRPYK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mms4NP_610611.1 ERCC4 48..179 CDD:280828 24/123 (20%)
eme2XP_021325918.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1595761at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.